Citrus Sinensis ID: 019438

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-

MDTKRVINIFIFILVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEAKEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINNKTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEVFLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNSNGFVDINMASAVSFVVIASCFLVMLYKLMSFWFIEVLVVLFCIGGVEGLQTCVVALLSWYVYSSFCICFFPTPILSLKDNYLYEEENWILTLFCPSMVTDV

ccccHHHHHHHHHHHHcccccccccCEECcccccccccccccEEEEEEEEEcccccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEECccccHHHHHHHHHHccccEEEEEEcccccccccccccccccCEEEEEEEEccHHHHHHHHHHHcccEEEEEEEcccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEECcccccccccccccHHHHHHHHHHcccccccc

****RVINIFIFILVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEAKEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINNKTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEVFLWLMAVGTILCASYWSAWTARETAIELDKLLK**************NGFVDINMASAVSFVVIASCFLVMLYKLMSFWFIEVLVVLFCIGGVEGLQTCVVALLSWYVYSSFCICFFPTPILSLKDNYLYEEENWILTLFCPSMVTDV

xxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal peptide peptidase-like 4	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	probable	Q0WMJ8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ICU, chain A
Confidence level:very confident
Coverage over the Query: 44-188
View the alignment between query and template
View the model in PyMOL

Template: 1Y9Z, chain A
Confidence level:probable
Coverage over the Query: 90-216
View the alignment between query and template
View the model in PyMOL