Citrus Sinensis ID: 019551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MQSPTLNFRVQISPTQLSMFLLKKWRVAAFGVYGYMNFTKNGFKEHSKNFKPEDMQARIEGKNCVVTGANAGIGYATAEGLASRGATVYMVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
cccccccEEEECcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccccCEEEccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEEcccHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccCEEEcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccc
*******FRVQISPTQLSMFLLKKWRVAAFGVYGYMNFTKNGFKEHSKNFKPEDMQARIEGKNCVVTGANAGIGYATAEGLASRGATVYMVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSPTLNFRVQISPTQLSMFLLKKWRVAAFGVYGYMNFTKNGFKEHSKNFKPEDMQARIEGKNCVVTGANAGIGYATAEGLASRGATVYMVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dehydrogenase/reductase SDR family member 12 Putative oxidoreductase.probableA6QP05
Dehydrogenase/reductase SDR family member 12 Putative oxidoreductase.probableA0PJE2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 50-260,277-338
View the alignment between query and template
View the model in PyMOL
Template: 4DA9, chain A
Confidence level:very confident
Coverage over the Query: 57-199,219-258,275-309
View the alignment between query and template
View the model in PyMOL
Template: 4BB6, chain A
Confidence level:probable
Coverage over the Query: 49-306
View the alignment between query and template
View the model in PyMOL