Citrus Sinensis ID: 019556

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MAFIAYEARKQFPEEKIWITNEIIHNPTVNKRLEEMAVQNIPVEEGKKQFDVVNKGDVVVLPAFGAAVEEMVTLNNKNVQIVDTTCPWVSKVWTSVEKHKKGDYTSIIHGKYSHEETVATASFAGKYIIVKNMKEAEYVCDYILGGELNGSSSTKEAFLEKFKKAVSKGFDPDVDLVKVGIANQTTMLKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICDATQERQDAMYKMVEEKVDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEALQLA
ccHHHHHHHHHcccccEEEEccccccHHHHHHHHHcccEEEccccccccccccccccEEEEccccccHHHHHHHHcccccEEEccccccHHHHHHHHHHHccccEEEEEcccccccEEEEccccccEEEEEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHccccHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHcccccHHccc
MAFIAYEARKQFPEEKIWITNEIIHNPTVNKRLEEMAVQNIPVEEGKKQFDVVNKGDVVVLPAFGAAVEEMVTLNNKNVQIVDTTCPWVSKVWTSVEKHKKGDYTSIIHGKYSHEETVATASFAGKYIIVKNMKEAEYVCDYILGGELNGSSSTKEAFLEKFKKAVSKGFDPDVDLVKVGIANQTTMLKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICDATQERQDAMYKMVEEKVDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEALQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFIAYEARKQFPEEKIWITNEIIHNPTVNKRLEEMAVQNIPVEEGKKQFDVVNKGDVVVLPAFGAAVEEMVTLNNKNVQIVDTTCPWVSKVWTSVEKHKKGDYTSIIHGKYSHEETVATASFAGKYIIVKNMKEAEYVCDYILGGELNGSSSTKEAFLEKFKKAVSKGFDPDVDLVKVGIANQTTMLKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICDATQERQDAMYKMVEEKVDLILVVGGWNSSNTSHLQEIAEDRGIPSYWIDSEKRIGPGNKIAYKLMHGELVEKENWLPKGQITIGITSGASTPDKAVEDVLKKVFEIKREEALQLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxy-3-methylbut-2-enyl diphosphate reductase Converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).probableP58674
4-hydroxy-3-methylbut-2-enyl diphosphate reductase Converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).probableB0JVA7
4-hydroxy-3-methylbut-2-enyl diphosphate reductase Converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).probableB7K4V8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.17.-.-Acting on CH or CH(2) groups.probable
1.17.1.-With NAD(+) or NADP(+) as acceptor.probable
1.17.1.24-hydroxy-3-methylbut-2-enyl diphosphate reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SZU, chain A
Confidence level:very confident
Coverage over the Query: 1-140,172-280,298-332
View the alignment between query and template
View the model in PyMOL
Template: 3HUU, chain A
Confidence level:probable
Coverage over the Query: 177-327
View the alignment between query and template
View the model in PyMOL