Citrus Sinensis ID: 019591


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MASPYRDRTAEFRSLSQTLKKIGGATTAVDQPNNSFVSPKPPNPASSRSEFNKKASRIGLGIHEASQKIARLAKLAKRSSMFDDPIVEIQELTALIKDDITALNMALSDLQTLQNLEIVEGNYSQDRVVHSTTVCDDLKSKLMGATKELQDVLTTRTENIKAHESRKQIFSANALRDSPFRQHAQPVTEPPPWSSPVNASESSQPSALPPGGVQVGNQLRRRPAVDNAPSHHMEMSMLQQVVPRQENYSQSRAVALHNVESTITELGGIFTHLATMVAQQGELAIRIDDNMDESLANVEGARNALLRHLNQISSNRWLMIKIFAVIIFFLTVFMFFVA
ccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHc
***********FRSL*********************************************GI*****KIARLAKLAKRSSMFDDPIVEIQELTALIKDDITALNMALSDLQTLQNLE************HSTTVCDDLKSKLMGATK*L**V****************************************************************************************************AVALHNVESTITELGGIFTHLATMVAQQGELAIRIDDNMDESLANVEGARNALLRHLNQISSNRWLMIKIFAVIIFFLTVFMFFVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASPYRDRTAEFRSLSQTLKKIGGATTAVDQPNNSFVSPKPPNPASSRSEFNKKASRIGLGIHEASQKIARLAKLAKRSSMFDDPIVEIQELTALIKDDITALNMALSDLQTLQNLEIVEGNYSQDRVVHSTTVCDDLKSKLMGATKELQDVLTTRTENIKAHESRKQIFSANALRDSPFRQHAQPVTEPPPWSSPVNASESSQPSALPPGGVQVGNQLRRRPAVDNAPSHHMEMSMLQQVVPRQENYSQSRAVALHNVESTITELGGIFTHLATMVAQQGELAIRIDDNMDESLANVEGARNALLRHLNQISSNRWLMIKIFAVIIFFLTVFMFFVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-31 Vesicle trafficking protein that functions in the secretory pathway.probableQ9FFK1
Integral membrane protein SED5 Required for vesicular transport between the endoplasmic reticulum and the Golgi complex. Acts as a target organelle soluble NSF attachment protein receptor (t-SNARE).probableQ01590
Integral membrane protein sed5 Required for vesicular transport between the endoplasmic reticulum and the Golgi complex. Acts as a target organelle soluble NSF attachment protein receptor (t-SNARE).probableO13644

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DN1, chain B
Confidence level:confident
Coverage over the Query: 45-204,222-302
View the alignment between query and template
View the model in PyMOL
Template: 3C98, chain B
Confidence level:confident
Coverage over the Query: 6-15,47-203,225-302
View the alignment between query and template
View the model in PyMOL