Citrus Sinensis ID: 019620


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MSDALINGLAGAGGGIIAQLITYPLQTVNARQQTERDVKKEKRKLGTVAQMCQVVKHEGWGRLYGGLTPSIVGTAASQGVYYYFYQIFRNNAEVAALEHKKRGIGDGSVGMLSSLVVAALAGCVNVLLTNPIWVVVTRMQTHTKTLKKSKPCRSELTSSEKSSHATVEPPPFATSHAIQEVYDEAGLWGFWRGVFPTLIMVSNPSIQFMLYETMLKKIKERRALRKKDNSGVTALEIFLLGALAKLGATIVTYPLLVVKARLQAKQVTTGDKRHHYKGTLDAILKMIRYEGFYGFYQGMGTKIVQSVLAAAVLFMIKEELVKGARFLLAQNKPKSKPP
ccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
*SDALINGLAGAGGGIIAQLITYPLQTVNAR************KLGTVAQMCQVVKHEGWGRLYGGLTPSIVGTAASQGVYYYFYQIFRNNAEVAAL*********GSVGMLSSLVVAALAGCVNVLLTNPIWVVVTRMQ****************************PPPFATSHAIQEVYDEAGLWGFWRGVFPTLIMVSNPSIQFMLYETMLKKIKERRALRKKDNSGVTALEIFLLGALAKLGATIVTYPLLVVKARLQAKQVTTGDKRHHYKGTLDAILKMIRYEGFYGFYQGMGTKIVQSVLAAAVLFMIKEELVKGARFLLA*********
xxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDALINGLAGAGGGIIAQLITYPLQTVNARQQTERDVKKEKRKLGTVAQMCQVVKHEGWGRLYGGLTPSIVGTAASQGVYYYFYQIFRNNAEVAALEHKKRGIGDGSVGMLSSLVVAALAGCVNVLLTNPIWVVVTRMQTHTKTLKKSKPCRSELTSSEKSSHATVEPPPFATSHAIQEVYDEAGLWGFWRGVFPTLIMVSNPSIQFMLYETMLKKIKERRALRKKDNSGVTALEIFLLGALAKLGATIVTYPLLVVKARLQAKQVTTGDKRHHYKGTLDAILKMIRYEGFYGFYQGMGTKIVQSVLAAAVLFMIKEELVKGARFLLAQNKPKSKPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal nicotinamide adenine dinucleotide carrier Mediates the NAD(+) import into peroxisomes. Favors the NAD(+)(in)/AMP(out) antiport exchange, but is also able to catalyze a low unidirectional transport that might be essential under special conditions. Transports CoA, dephospho-CoA, acetyl-CoA, adenosine 3',5'-diphosphate (PAP), NAD(+), AMP, ADP and NADH, but has no activity with ATP, GTP, GDP, NADPH, NADP(+) or FAD. Required for peroxisomes proliferation.confidentO04200
Peroxisomal membrane protein PMP34 Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extend for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. Inhibited by pyridoxal 5'-phosphate and bathophenanthroline in vitro.probableO43808
Mitochondrial substrate carrier family protein Q May have transport activity.probableQ76P23

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 6-96,107-145,166-334
View the alignment between query and template
View the model in PyMOL