Citrus Sinensis ID: 019623

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34

MKNNINTKLILLRPSTIHKPTTTTTTITTHRFYLLFFLTFFTLAFTLTFFTTAINPASSVASTAKSLPSSSSSSSSIITAALLHYTLTSNSTMTSAELTAVADALSRCSPSCNFLVFGLTHETLLWKSLNFQGHTIFVDESEFLVQSFEKNHPDFEIYDVQYTTKVEEMNPTLHAVRKQFKDDCRPMQNLLFSDCKLAINDMPNHVYDMDWDVVLVDGPSGYFPRAPGRMAPIFTASVLARSKKAGRKKTHVFVHDFNREVERVCSEEFLCEENLVEVVDKLAHFVVEPMAPIEGNEEQSFKFCKSSSPSSSLSSPSSSDDDDYHSLIEDGHHGDDDA

ccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccccccccccccHHHHcHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHccccccHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccc

******T****LR*****************RFYLLFFLTFFTLAFTLTFFTTA***********************IITAALLHYTLTSNSTMTSAELTAVADALSRCSPSCNFLVFGLTHETLLWKSLNFQGHTIFVDESEFLVQSFEKNHPDFEIYDVQYTTKVEEMNPTLHAVRKQFKDDCRPMQNLLFSDCKLAINDMPNHVYDMDWDVVLVDGPSGYFPRAPGRMAPIFTASVLA******RKKTHVFVHDFNREVERVCSEEFLCEENLVEVVDKLAHFVVEPM************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein IRX15-LIKE	Required for xylan biosynthesis, but not directly involved in catalyzing the addition of sugars to the growing polymer.	probable	Q9FH92

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CVO, chain A
Confidence level:confident
Coverage over the Query: 94-290
View the alignment between query and template
View the model in PyMOL

Template: 3C6K, chain A
Confidence level:probable
Coverage over the Query: 109-179,208-289
View the alignment between query and template
View the model in PyMOL