Citrus Sinensis ID: 019669

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------

MMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY

cccEEEcccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHEEEEHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc

*MAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS*PSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY

xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Amino acid permease 3	Amino acid-proton symporter. Stereospecific transporter with a broad specificity for GABA, tryptophan and both neutral and basic amino acids. High affinity transport of cationic amino acids.	probable	Q39134

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 98-162
View the alignment between query and template
View the model in PyMOL

Template: 2JLN, chain A
Confidence level:probable
Coverage over the Query: 24-58
View the alignment between query and template
View the model in PyMOL