Citrus Sinensis ID: 019669


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY
cccEEEcccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHEEEEHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*MAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKS*PSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKCYNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amino acid permease 3 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for GABA, tryptophan and both neutral and basic amino acids. High affinity transport of cationic amino acids.probableQ39134

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 98-162
View the alignment between query and template
View the model in PyMOL
Template: 2JLN, chain A
Confidence level:probable
Coverage over the Query: 24-58
View the alignment between query and template
View the model in PyMOL