Citrus Sinensis ID: 019686


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MYLSEKPRPYLTEKPRPIDYYKDEAVAAAAAAAAAASSRDMIMEVAAASNGELQPQQMILADSSGGEDHEVRAPKKRAETWVQDETRILIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKTKHQDRGSGSAKMSYYKEIDEILKERSKNAQYKATSVANSANKVDTFMQFSDKGFDDTSISFGPVEATGRPTLNLERRLDHDGHPLAITTADAVAAAGVPPWNWRDPPPGNGGEGQSFGGKVISVKCGDYTRRIGIDGTPDAIKEAIKSAFGIRTKRAFWLEDEDQIVRCIDRDMPVGNYTLHLDEGKLLHMWFL
cccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEECccccEEECccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccEEEEcccccEEEEEcc
*******************************************************************************TWVQDETRILIAFRREMDGLFNTS***KHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFK***************YYKEIDEIL*******************************************************LDHDGHPLAITTADAVAAAGVPPWNWR************FGGKVISVKCGDYTRRIGIDGTPDAIKEAIKSAFGIRTKRAFWLEDEDQIVRCIDRDMPVGNYTLHLDEGKLLHMWFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLSEKPRPYLTEKPRPIDYYKDEAVAAAAAAAAAASSRDMIMEVAAASNGELQPQQMILADSSGGEDHEVRAPKKRAETWVQDETRILIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKTKHQDRGSGSAKMSYYKEIDEILKERSKNAQYKATSVANSANKVDTFMQFSDKGFDDTSISFGPVEATGRPTLNLERRLDHDGHPLAITTADAVAAAGVPPWNWRDPPPGNGGEGQSFGGKVISVKCGDYTRRIGIDGTPDAIKEAIKSAFGIRTKRAFWLEDEDQIVRCIDRDMPVGNYTLHLDEGKLLHMWFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trihelix transcription factor GT-1 Probable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals.probableQ9FX53

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EBI, chain A
Confidence level:very confident
Coverage over the Query: 75-160
View the alignment between query and template
View the model in PyMOL