Citrus Sinensis ID: 019722


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MLETVKYLLGSAGASGYGSKSTAEQVTDGCPNLSSVTAIITGATSGIGAETARVLAKRGARLVLPARSLKAAEEAKARLASDCPGSDIVVLPLDLSSLSSVRNFVSQFHSLNLPLNLLINNAGKFAHQHAISEDGIEMTFATNYLGHFLLTKLLLKKMIETAKATGIQGRIVNVSSSIHSWFSGDMIRYLGQISRNKSHYDATRAYALSKLANVLHTKELAQRLKQMEANVTVNCVHPGIVRTRLTREREGFITDLVFFLTSKLLKTIPQGAATTCYVAIHPRLVNVSGKYFADCNEAWTSKLGSNSNEASRLWAASELLVSRDPKSVFDPLSAND
cHHHHHHHHcccccccccccccHHHHHcccccccccEEEEccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEECccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccc
*****KYLLGSAG*****S**TAEQVTDGCPNLSSVTAIITGATSGIGAETARVLAKRGARLVLPARSLKAAEEAKARLASDCPGSDIVVLPLDLSSLSSVRNFVSQFHSLNLPLNLLINNAGKFAHQHAISEDGIEMTFATNYLGHFLLTKLLLKKMIETAKATGIQGRIVNVSSSIHSWFSGDMIRYLGQISRNKSHYDATRAYALSKLANVLHTKELAQRLKQMEANVTVNCVHPGIVRTRLTREREGFITDLVFFLTSKLLKTIPQGAATTCYVAIHPRLVNVSGKYFADCNEAWTSKLGSNSNEASRLWAASELLVSRDPKS*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLETVKYLLGSAGASGYGSKSTAEQVTDGCPNLSSVTAIITGATSGIGAETARVLAKRGARLVLPARSLKAAEEAKARLASDCPGSDIVVLPLDLSSLSSVRNFVSQFHSLNLPLNLLINNAGKFAHQHAISEDGIEMTFATNYLGHFLLTKLLLKKMIETAKATGIQGRIVNVSSSIHSWFSGDMIRYLGQISRNKSHYDATRAYALSKLANVLHTKELAQRLKQMEANVTVNCVHPGIVRTRLTREREGFITDLVFFLTSKLLKTIPQGAATTCYVAIHPRLVNVSGKYFADCNEAWTSKLGSNSNEASRLWAASELLVSRDPKSVFDPLSAND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 30-245,266-324
View the alignment between query and template
View the model in PyMOL
Template: 4DYV, chain A
Confidence level:very confident
Coverage over the Query: 35-182,200-241,267-289
View the alignment between query and template
View the model in PyMOL