Citrus Sinensis ID: 019748


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MDFSLENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSRAVSSILQFSCKFDPFLSYLAVNYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQIEFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQRALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKENLLRCYNAMQDTSMDDEYESEIDLVSSSYTPVNVLDCRVSSSGSDKTNVTTTDTKATSSSSDSSTTSTELSPERDTKRRKLSSYRNNHSIQLSQTQQC
ccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccHHccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccc
*DFS*ENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSRAVSSILQFSCKFDPFLSYLAVNYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQIEFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQRALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKENLLRCYNAMQD**********IDLVSSSYTPVNVLDCRV*****************************************************S*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFSLENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSRAVSSILQFSCKFDPFLSYLAVNYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQIEFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQRALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKENLLRCYNAMQDTSMDDEYESEIDLVSSSYTPVNVLDCRVSSSGSDKTNVTTTDTKATSSSSDSSTTSTELSPERDTKRRKLSSYRNNHSIQLSQTQQC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative cyclin-D6-1 probableQ9ZR04
Cyclin-D6-1 probableQ69S43

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G33, chain B
Confidence level:very confident
Coverage over the Query: 23-252
View the alignment between query and template
View the model in PyMOL
Template: 2CCH, chain B
Confidence level:very confident
Coverage over the Query: 20-252,264-281
View the alignment between query and template
View the model in PyMOL