Citrus Sinensis ID: 019766

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MHFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLPV
cccccccEEEEcccccccccccEEEEEEcccccccccEEEEEEEEEEcccHHHHHHHHcHHHHHEEEEEccccccccccccEEEEEEEEEccccccccEEEEEEEEEcccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccEEEEEEEEEEccccccccccEEEEEEEcccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccccccEEEEEEEEEEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHEEHHccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccc
mhfvlgctVICEINVFPVCFSYHRHIYLLandhqpcafhlGQVVRMVVGNMEAGHLYSRLIPLVLLLvdgsnpidvtdpRWELYILIRKKMDQQGDIQHRLLGFTAIYrfyhypdstrmrlsqililppyqrkgyggfLTEVLSNVAVaenvhdftveepldsfqhvrtcvdiqhllafePIQHAINSAVSHLkqgklskkilaprfvppastVEEVRKVLKINKKQFLQCWEILIYlrldpvdkyMEDYTTIISNrvredilgkdsgstdkrimdvpssydpemsfVMFKsqnvetsgvqmdenqpsQEEQLKQLVDERIKEIKLIAQKVSPLPV
MHFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKilaprfvppastveEVRKVLKINKKQFLQCWEILIylrldpvdkYMEDYTTiisnrvredilgkdsgstdkrimDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKliaqkvsplpv
MHFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLPV
**FVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDIL*************************************************************************
******CTVICEINVFPVCFSYH*************AFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAIN*******************FVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRV*****************DVPSSYDPEMSF**************************KQLVDERIKEIKLIAQKVSPL**
MHFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVE***************QLKQLVDERIKEIKLIA********
*HFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFVLGCTVICEINVFPVCFSYHRHIYLLANDHQPCAFHLGQVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query336 2.2.26 [Sep-21-2011]
Q9FJT8467 Histone acetyltransferase yes no 0.863 0.620 0.641 1e-109
Q6ES10466 Probable histone acetyltr yes no 0.833 0.600 0.445 2e-68
Q8LPU4468 Histone acetyltransferase N/A no 0.830 0.596 0.470 6e-66
Q869X7466 Histone acetyltransferase yes no 0.494 0.356 0.312 1e-21
Q86J12486 Histone acetyltransferase no no 0.532 0.368 0.299 1e-21
Q4PBE6448 Histone acetyltransferase N/A no 0.517 0.388 0.301 1e-18
Q12341374 Histone acetyltransferase yes no 0.485 0.435 0.300 3e-17
Q59VF4413 Histone acetyltransferase N/A no 0.5 0.406 0.290 4e-16
P0CO06416 Histone acetyltransferase yes no 0.502 0.406 0.281 2e-15
P0CO07416 Histone acetyltransferase N/A no 0.502 0.406 0.281 2e-15
>sp|Q9FJT8|HATB_ARATH Histone acetyltransferase type B catalytic subunit OS=Arabidopsis thaliana GN=HAG2 PE=2 SV=1 Back     alignment and function desciption
 Score =  395 bits (1014), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 240/293 (81%), Gaps = 3/293 (1%)

Query: 42  QVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRL 101
           QV+RM +G+  AG LYSRL+PLVLL VDGSNPIDVTDP W LY+LI+KK +++ D  +R+
Sbjct: 168 QVIRMEIGSPNAGLLYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKE-DPLYRI 226

Query: 102 LGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPL 161
           +GFTAIY+FY YPD  RMRLSQIL+LP +Q KG G +L EV++NVA+ ENV+D TVEEP 
Sbjct: 227 VGFTAIYKFYRYPDRLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLTVEEPS 286

Query: 162 DSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVL 221
           + FQH+RTC+DI  L +F+PI+  I+SAV  L +GKLSKK   PRF PP + +E+VR+ L
Sbjct: 287 EKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESL 346

Query: 222 KINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSY 281
           KINKKQFL+CWEILIYL LDP+DKYMEDYT++I+N VR DILGKD  +  K+++DVPSS+
Sbjct: 347 KINKKQFLKCWEILIYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSF 406

Query: 282 DPEMSFVMFKSQNVE--TSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS 332
           +PE SFV+FKS N E   + VQ+DEN+P QE+QLKQLV+ERI+EIKL+A+KVS
Sbjct: 407 EPEASFVVFKSVNGEEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVS 459
Acetylates soluble but not nucleosomal H4 (By similarity). Acetylates 'Lys-12' of histone H4.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q6ES10|HAT1_ORYSJ Probable histone acetyltransferase type B catalytic subunit OS=Oryza sativa subsp. japonica GN=HATB PE=2 SV=1 Back     alignment and function description
>sp|Q8LPU4|HAT1_MAIZE Histone acetyltransferase type B catalytic subunit OS=Zea mays GN=HAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q869X7|HAT12_DICDI Histone acetyltransferase type B catalytic subunit DDB_G0275159 OS=Dictyostelium discoideum GN=DDB_G0275159 PE=3 SV=1 Back     alignment and function description
>sp|Q86J12|HAT11_DICDI Histone acetyltransferase type B catalytic subunit DDB_G0274269 OS=Dictyostelium discoideum GN=DDB_G0274269 PE=3 SV=1 Back     alignment and function description
>sp|Q4PBE6|HAT1_USTMA Histone acetyltransferase type B catalytic subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT1 PE=3 SV=1 Back     alignment and function description
>sp|Q12341|HAT1_YEAST Histone acetyltransferase type B catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAT1 PE=1 SV=1 Back     alignment and function description
>sp|Q59VF4|HAT1_CANAL Histone acetyltransferase type B catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAT1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO06|HAT1_CRYNJ Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO07|HAT1_CRYNB Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
255546221 460 histone acetyltransferase type B catalyt 0.875 0.639 0.705 1e-123
297738707 511 unnamed protein product [Vitis vinifera] 0.869 0.571 0.660 1e-115
225444999 462 PREDICTED: histone acetyltransferase typ 0.869 0.632 0.660 1e-115
147840664 482 hypothetical protein VITISV_007880 [Viti 0.866 0.603 0.663 1e-114
356551642 473 PREDICTED: histone acetyltransferase typ 0.898 0.638 0.658 1e-114
356501087 473 PREDICTED: histone acetyltransferase typ 0.866 0.615 0.676 1e-113
357492375 466 Histone acetyltransferase type B catalyt 0.872 0.628 0.659 1e-112
15241925 467 histone acetyltransferase type B catalyt 0.863 0.620 0.641 1e-107
297796559 474 histone acetyltransferase family protein 0.863 0.611 0.638 1e-107
224123946246 histone acetyltransferase [Populus trich 0.723 0.987 0.732 1e-102
>gi|255546221|ref|XP_002514170.1| histone acetyltransferase type B catalytic subunit, putative [Ricinus communis] gi|223546626|gb|EEF48124.1| histone acetyltransferase type B catalytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  449 bits (1155), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/302 (70%), Positives = 255/302 (84%), Gaps = 8/302 (2%)

Query: 39  HLGQ------VVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMD 92
           HLG+      V RM +GN  AGHLYSRLIPLVLLL+DGSNPIDV DP WEL++LI +K D
Sbjct: 161 HLGEPTSDMKVFRMAIGNTGAGHLYSRLIPLVLLLIDGSNPIDVADPGWELFVLIHEKND 220

Query: 93  QQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENV 152
           +QGDIQHRLLGFTA+YRFYHYPD TR+RLSQIL+LPPYQ KGYG  L EV++ VA++E+V
Sbjct: 221 EQGDIQHRLLGFTAVYRFYHYPDKTRLRLSQILVLPPYQHKGYGRQLVEVVNKVAISEDV 280

Query: 153 HDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPAS 212
           +DFTVEEPLD FQHVRTCVDIQ LLAF+ IQ AINSAVS+LKQGKLSK+   PRF+PP++
Sbjct: 281 YDFTVEEPLDHFQHVRTCVDIQRLLAFDAIQDAINSAVSNLKQGKLSKRAHVPRFIPPST 340

Query: 213 TVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDK 272
            ++ VRK LKIN+KQFLQCWE+LIYL LD  DK MED+ TIISNRV+ DILGKDSGS  K
Sbjct: 341 AIDAVRKTLKINRKQFLQCWEVLIYLGLDSEDKGMEDFATIISNRVKADILGKDSGSGGK 400

Query: 273 RIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS 332
           ++++VPS Y+PEMSFVMF+S +     +QMDENQ +Q+EQL+QLVDER+KEIKLIAQK+ 
Sbjct: 401 QVIEVPSYYNPEMSFVMFRSGS--EGSIQMDENQTNQKEQLQQLVDERLKEIKLIAQKLR 458

Query: 333 PL 334
           P+
Sbjct: 459 PV 460

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738707|emb|CBI27952.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444999|ref|XP_002282931.1| PREDICTED: histone acetyltransferase type B catalytic subunit [Vitis vinifera] Back     alignment and taxonomy information
>gi|147840664|emb|CAN62002.1| hypothetical protein VITISV_007880 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356551642|ref|XP_003544183.1| PREDICTED: histone acetyltransferase type B catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|356501087|ref|XP_003519360.1| PREDICTED: histone acetyltransferase type B catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|357492375|ref|XP_003616476.1| Histone acetyltransferase type B catalytic subunit [Medicago truncatula] gi|355517811|gb|AES99434.1| Histone acetyltransferase type B catalytic subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|15241925|ref|NP_200485.1| histone acetyltransferase type B catalytic subunit [Arabidopsis thaliana] gi|75171099|sp|Q9FJT8.1|HATB_ARATH RecName: Full=Histone acetyltransferase type B catalytic subunit; Short=HAT B gi|10176778|dbj|BAB09892.1| histone acetyltransferase HAT B [Arabidopsis thaliana] gi|95147282|gb|ABF57276.1| At5g56740 [Arabidopsis thaliana] gi|332009419|gb|AED96802.1| histone acetyltransferase type B catalytic subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297796559|ref|XP_002866164.1| histone acetyltransferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297311999|gb|EFH42423.1| histone acetyltransferase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224123946|ref|XP_002319203.1| histone acetyltransferase [Populus trichocarpa] gi|222857579|gb|EEE95126.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
TAIR|locus:2165091467 HAG2 "histone acetyltransferas 0.863 0.620 0.641 1.7e-100
DICTYBASE|DDB_G0275159466 DDB_G0275159 "putative histone 0.738 0.532 0.275 1.9e-21
DICTYBASE|DDB_G0274269486 DDB_G0274269 "putative histone 0.586 0.405 0.303 2.9e-21
FB|FBgn0037376405 CG2051 [Drosophila melanogaste 0.372 0.308 0.364 1.6e-17
ZFIN|ZDB-GENE-040912-99408 hat1 "histone acetyltransferas 0.339 0.279 0.336 9.8e-16
UNIPROTKB|F1P5A3408 HAT1 "Uncharacterized protein" 0.488 0.401 0.295 9.2e-15
UNIPROTKB|F1S084419 HAT1 "Uncharacterized protein" 0.428 0.343 0.326 2.4e-14
UNIPROTKB|Q58DR1413 HAT1 "Histone acetyltransferas 0.339 0.276 0.353 5.5e-14
UNIPROTKB|F1PUX9413 HAT1 "Uncharacterized protein" 0.339 0.276 0.353 5.5e-14
CGD|CAL0001952413 HAT1 [Candida albicans (taxid: 0.497 0.404 0.302 1.3e-13
TAIR|locus:2165091 HAG2 "histone acetyltransferase of the GNAT family 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 997 (356.0 bits), Expect = 1.7e-100, P = 1.7e-100
 Identities = 188/293 (64%), Positives = 240/293 (81%)

Query:    42 QVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRL 101
             QV+RM +G+  AG LYSRL+PLVLL VDGSNPIDVTDP W LY+LI+KK +++ D  +R+
Sbjct:   168 QVIRMEIGSPNAGLLYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKE-DPLYRI 226

Query:   102 LGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVAENVHDFTVEEPL 161
             +GFTAIY+FY YPD  RMRLSQIL+LP +Q KG G +L EV++NVA+ ENV+D TVEEP 
Sbjct:   227 VGFTAIYKFYRYPDRLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLTVEEPS 286

Query:   162 DSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVL 221
             + FQH+RTC+DI  L +F+PI+  I+SAV  L +GKLSKK   PRF PP + +E+VR+ L
Sbjct:   287 EKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESL 346

Query:   222 KINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSY 281
             KINKKQFL+CWEILIYL LDP+DKYMEDYT++I+N VR DILGKD  +  K+++DVPSS+
Sbjct:   347 KINKKQFLKCWEILIYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSF 406

Query:   282 DPEMSFVMFKSQNVE--TSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS 332
             +PE SFV+FKS N E   + VQ+DEN+P QE+QLKQLV+ERI+EIKL+A+KVS
Sbjct:   407 EPEASFVVFKSVNGEEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVS 459
GO:0004402 "histone acetyltransferase activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006348 "chromatin silencing at telomere" evidence=IEA
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0016568 "chromatin modification" evidence=IEA
GO:0016573 "histone acetylation" evidence=IEA
GO:0010485 "H4 histone acetyltransferase activity" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
DICTYBASE|DDB_G0275159 DDB_G0275159 "putative histone acetyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274269 DDB_G0274269 "putative histone acetyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0037376 CG2051 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-99 hat1 "histone acetyltransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5A3 HAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S084 HAT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DR1 HAT1 "Histone acetyltransferase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUX9 HAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
CGD|CAL0001952 HAT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FJT8HATB_ARATH2, ., 3, ., 1, ., 4, 80.64160.86300.6209yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.921
3rd Layer2.3.1.480.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016608001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (462 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00015313001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (439 aa)
      • 0.415

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 2e-04
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 2e-04
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 4e-04
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information 
 Score = 41.5 bits (98), Expect = 2e-04
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 121 LSQILILPPYQRKGYGGFLTE 141
           L+ IL LPPYQRKGYG  L +
Sbjct: 83  LACILTLPPYQRKGYGKLLID 103

This region of these proteins has been suggested to be homologous to acetyltransferases. Length = 189
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 336
KOG2696403 consensus Histone acetyltransferase type b catalyt 100.0
PLN03239351 histone acetyltransferase; Provisional 99.9
PLN03238290 probable histone acetyltransferase MYST; Provision 99.88
PTZ00064552 histone acetyltransferase; Provisional 99.88
PLN00104450 MYST -like histone acetyltransferase; Provisional 99.84
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 99.84
KOG2747396 consensus Histone acetyltransferase (MYST family) 99.83
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 99.81
PF10394161 Hat1_N: Histone acetyl transferase HAT1 N-terminus 98.29
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 97.82
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 97.61
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 97.49
PTZ00330147 acetyltransferase; Provisional 97.47
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 97.43
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 97.25
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 97.17
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 97.09
PHA01807153 hypothetical protein 97.03
PRK10314153 putative acyltransferase; Provisional 96.9
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 96.82
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 96.76
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 96.73
PRK03624140 putative acetyltransferase; Provisional 96.65
PRK07757152 acetyltransferase; Provisional 96.62
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 96.54
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 96.52
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 96.49
PRK05279441 N-acetylglutamate synthase; Validated 96.36
PLN02825515 amino-acid N-acetyltransferase 96.31
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 96.3
PRK10140162 putative acetyltransferase YhhY; Provisional 96.25
PRK13688156 hypothetical protein; Provisional 96.17
PRK09831147 putative acyltransferase; Provisional 96.12
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 96.09
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 95.91
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 95.83
PRK10514145 putative acetyltransferase; Provisional 95.82
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 95.73
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 95.6
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 95.5
PRK10562145 putative acetyltransferase; Provisional 95.48
PRK07922169 N-acetylglutamate synthase; Validated 95.28
PRK15130186 spermidine N1-acetyltransferase; Provisional 95.19
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 95.18
PHA00673154 acetyltransferase domain containing protein 94.97
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 94.82
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 94.79
COG0456177 RimI Acetyltransferases [General function predicti 94.66
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 94.47
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 94.43
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 94.32
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 94.21
PRK01346 411 hypothetical protein; Provisional 93.94
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 93.39
KOG3139165 consensus N-acetyltransferase [General function pr 92.67
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 91.87
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 91.84
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 91.56
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 91.32
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 91.23
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 90.13
COG1247169 Sortase and related acyltransferases [Cell envelop 89.92
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 89.04
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 87.9
COG5628143 Predicted acetyltransferase [General function pred 86.71
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 86.57
>KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=100.00  E-value=6.7e-62  Score=471.95  Aligned_cols=264  Identities=31%  Similarity=0.493  Sum_probs=232.8

Q ss_pred             CccccccCC----eEEEEcCCccHHHHHHhHhhhHhhhcccCCCCCCCCCceEEEEEEEeecCCCCCcceEEEEEeeeee
Q 019766           34 QPCAFHLGQ----VVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYR  109 (336)
Q Consensus        34 ~vc~y~~~~----I~k~~l~d~~~~~l~~rlq~f~l~FIe~aS~id~dd~~W~~f~lyek~~~~~~~~~y~~vGy~T~Y~  109 (336)
                      ++++|+..+    |||+.+++|.++.+|.|||+|+|||||++|+||.+|+.|++|++|||... ++.+.|+.+||.|+|+
T Consensus       130 ~vh~y~~~ge~~~vyk~~~~~~~f~~~~~Rlqt~~llFie~~~~id~tde~w~~~lv~EK~~~-d~~~ly~~~gy~tiyk  208 (403)
T KOG2696|consen  130 KVHEYSLDGEEFQVYKMEIGSPNFRLFHERLQTFSLLFIEAASYIDNTDECWLIYLVYEKKEE-DGDTLYAYVGYYTIYK  208 (403)
T ss_pred             hhhhheecCceEEEEEeecCChhHHHHHHhHHHHHHHHHhhcchhccCCCceEEEEeeeeccc-CCceeEeeeeeEEEee
Confidence            788998877    99999999999999999999999999999999999999999999999943 7899999999999999


Q ss_pred             eccCCCCCCcceeeEEecCCCCCCChhhHHHHHHHH-HhhcCCceeeecCCCchhHHHhhhHHHHHHhhccchhhHhhhh
Q 019766          110 FYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSN-VAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINS  188 (336)
Q Consensus       110 f~~yP~~~R~RISQ~LILPPyQ~~G~Gs~Ll~~iy~-~~~~~~V~EITVEDPse~F~~LRD~vDl~~L~~~~~~~~~~~~  188 (336)
                      ||.||++.|+||||||||||||++|||+.|+|+|+. +..+|+|.|||||||||+|++|||+||+.+|.+++.+.+    
T Consensus       209 ~y~yid~~R~RiSQmlilpPfq~~Glgs~l~E~i~r~~~~~p~v~DiTVEdPse~F~~LRD~vd~~r~~sl~~fS~----  284 (403)
T KOG2696|consen  209 FYEYIDRIRPRISQMLILPPFQGKGLGSQLYEAIARDYLEEPTVLDITVEDPSEAFDSLRDRVDIVRLRSLDVFSP----  284 (403)
T ss_pred             hhhhhhhhhhhhheeEEeccccCCchHHHHHHHHHHhhccCCceeEEEecCchHHHHHHHHHHHHHHhcccccCCh----
Confidence            999999999999999999999999999999999997 577999999999999999999999999999998874321    


Q ss_pred             hhhhcccCcccccccCCCCCCChHHHHHHHHHhCCchhHHHHHHHHHHHhhcCCCc-hhhHHHHHHHHHhhHhhhhcCCC
Q 019766          189 AVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDS  267 (336)
Q Consensus       189 ~v~~l~~~~~~k~~~~~~~~~~~~~~e~~r~klKI~krQ~~Rv~Eilll~~l~~~d-~~~~~fRl~VK~RL~~~~~~~~~  267 (336)
                        ..+.+|            .+.+|++++|+++||+++||+||||||+|..+++.| ...+.||+.||+||++.+.    
T Consensus       285 --~~~h~~------------~s~~~~~~a~e~lKLn~~Q~~r~~EIl~l~~~~~~d~~e~~s~rl~ik~Rl~~~~~----  346 (403)
T KOG2696|consen  285 --ESIHPG------------FSDEMIEKAREALKLNKRQFRRVYEILRLLATDKKDKEEYKSFRLDIKRRLYAPNK----  346 (403)
T ss_pred             --hhhccc------------hhHHHHHHHHHHhccCHHHHHHHHHHHHHHhcccchhhcccceeecchhhhhhhhH----
Confidence              111111            137899999999999999999999999999999999 6677999999999988776    


Q ss_pred             CCCcccccccCCCCCCCCceeEeeecCccccccccCCCcccHHHHHHHHHHHHHHHHHHHHHhcC
Q 019766          268 GSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS  332 (336)
Q Consensus       268 ~~~~K~~~~~~~~~~~~~~f~m~~~~~~~~~~~qm~~~~~~~~e~L~e~~~~~~~~~~~v~~~v~  332 (336)
                          |.+.+++++..+.++|+|++..      +||+.+  .+.+||.|-+...+++|++.++++.
T Consensus       347 ----k~~~dl~k~~~~~~~~el~k~~------nq~d~e--~~~eqL~e~~~~l~edy~r~i~kl~  399 (403)
T KOG2696|consen  347 ----KQLLDLDKSERPLAPFELEKAH------NQPDQE--QQYEQLVEEFIRLKEDYRRKIEKLA  399 (403)
T ss_pred             ----HHHHhHHHhhcccCcHHHHHhh------cCCCHH--HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                6677888888888888886664      366544  5778888888888888888887754

>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>PF10394 Hat1_N: Histone acetyl transferase HAT1 N-terminus; InterPro: IPR019467 This entry represents the N-terminal half of the structure of histone acetyl transferase HAT1 Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
1bob_A320 Histone Acetyltransferase Hat1 From Saccharomyces C 7e-18
2p0w_A324 Human Histone Acetyltransferase 1 (Hat1) Length = 3 1e-13
>pdb|1BOB|A Chain A, Histone Acetyltransferase Hat1 From Saccharomyces Cerevisiae In Complex With Acetyl Coenzyme A Length = 320 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 99/199 (49%), Gaps = 40/199 (20%)
Query: 53  AGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYH 112
           A  ++ R+    LL ++ +N ID TDP W++Y L+ KK  +       L+GF   Y+++H
Sbjct: 146 ARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKE-------LIGFVTTYKYWH 198
Query: 113 YPDST----------RMRLSQILILPPYQRKGYGGFLTE-VLSNVAVAENVHDFTVEEPL 161
           Y  +           R ++SQ LI PPYQ KG+G  L E ++ +    +++ + TVE+P 
Sbjct: 199 YLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPN 258
Query: 162 DSFQHVRTCVDIQHL--LAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRK 219
           ++F  +R   DIQ L  L ++ +           K   LS + L           E  RK
Sbjct: 259 EAFDDLRDRNDIQRLRKLGYDAVFQ---------KHSDLSDEFL-----------ESSRK 298
Query: 220 VLKINKKQFLQCWEILIYL 238
            LK+ ++QF +  E+L+ L
Sbjct: 299 SLKLEERQFNRLVEMLLLL 317
>pdb|2P0W|A Chain A, Human Histone Acetyltransferase 1 (Hat1) Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 4e-55
1bob_A320 HAT1, histone acetyltransferase; histone modificat 3e-46
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Length = 324 Back     alignment and structure
 Score =  182 bits (462), Expect = 4e-55
 Identities = 52/201 (25%), Positives = 89/201 (44%), Gaps = 20/201 (9%)

Query: 42  QVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRL 101
           Q+ +  +        + RL   ++  ++ ++ IDV D RW  +++  K  ++ G      
Sbjct: 143 QIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFAT 201

Query: 102 LGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVA-ENVHDFTVEEP 160
           +G+  +Y +Y YPD TR R+SQ+LIL P+Q +G+G  L E +         V D T E+P
Sbjct: 202 VGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDP 261

Query: 161 LDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKV 220
             S+  +R  V ++                        S++ L   F        E ++ 
Sbjct: 262 SKSYVKLRDFVLVKLC----------------QDLPCFSREKLMQGF--NEDMAIEAQQK 303

Query: 221 LKINKKQFLQCWEILIYLRLD 241
            KINK+   + +EIL  L  D
Sbjct: 304 FKINKQHARRVYEILRLLVTD 324
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 320 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 100.0
1bob_A320 HAT1, histone acetyltransferase; histone modificat 100.0
2ou2_A280 Histone acetyltransferase htatip; structural genom 99.88
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 99.88
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 99.88
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 99.88
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 97.9
3mgd_A157 Predicted acetyltransferase; structural genomics, 97.81
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 97.78
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 97.78
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 97.76
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 97.72
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 97.7
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 97.69
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 97.69
3efa_A147 Putative acetyltransferase; structural genom 2, pr 97.68
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 97.67
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 97.63
1tiq_A180 Protease synthase and sporulation negative regulat 97.62
2fe7_A166 Probable N-acetyltransferase; structural genomics, 97.6
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 97.6
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 97.59
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 97.59
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 97.59
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 97.59
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 97.57
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 97.57
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 97.56
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 97.56
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 97.55
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 97.55
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 97.53
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 97.53
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 97.52
3owc_A188 Probable acetyltransferase; structural genomics, P 97.52
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 97.51
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 97.46
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 97.46
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 97.46
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 97.45
2fl4_A149 Spermine/spermidine acetyltransferase; structural 97.45
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 97.42
2gan_A190 182AA long hypothetical protein; alpha-beta protei 97.41
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 97.41
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 97.41
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 97.4
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 97.39
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 97.38
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 97.36
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 97.36
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 97.36
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 97.35
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 97.35
1z4r_A168 General control of amino acid synthesis protein 5- 97.35
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 97.33
2eui_A153 Probable acetyltransferase; dimer, structural geno 97.33
2aj6_A159 Hypothetical protein MW0638; structural genomics, 97.32
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 97.31
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 97.31
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 97.3
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 97.3
1wwz_A159 Hypothetical protein PH1933; structural genomics, 97.3
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 97.29
1y7r_A133 Hypothetical protein SA2161; structural genomics, 97.29
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 97.29
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 97.28
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 97.27
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 97.25
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 97.25
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 97.25
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 97.24
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 97.24
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 97.24
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 97.21
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 97.2
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 97.19
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 97.19
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 97.17
1xeb_A150 Hypothetical protein PA0115; midwest center for st 97.16
1vkc_A158 Putative acetyl transferase; structural genomics, 97.16
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 97.15
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 97.15
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 97.15
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 97.1
3juw_A175 Probable GNAT-family acetyltransferase; structural 97.1
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 97.1
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 97.09
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 97.08
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 97.08
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 97.07
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 97.06
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 97.05
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 97.05
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 97.03
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 97.03
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 97.02
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 97.02
3frm_A254 Uncharacterized conserved protein; APC61048, staph 97.01
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 97.01
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 97.01
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 97.0
3kkw_A182 Putative uncharacterized protein; acetyltransferas 97.0
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 96.98
2i6c_A160 Putative acetyltransferase; GNAT family, structura 96.98
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 96.97
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 96.97
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 96.96
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 96.93
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 96.9
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 96.89
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 96.89
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 96.89
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 96.88
1nsl_A184 Probable acetyltransferase; structural genomics, h 96.87
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 96.87
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 96.84
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 96.82
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 96.8
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 96.77
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 96.76
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 96.68
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 96.56
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 96.52
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 96.47
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 96.44
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 96.44
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 96.42
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 96.37
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 96.36
2qml_A198 BH2621 protein; structural genomics, joint center 96.16
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 96.15
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 96.13
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 96.01
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 95.97
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 95.89
1xmt_A103 Putative acetyltransferase; structural genomics, p 95.88
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 95.87
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 95.86
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 95.85
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 95.83
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 95.83
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 95.72
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 95.67
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 95.59
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 95.54
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 95.48
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 95.42
2i00_A406 Acetyltransferase, GNAT family; structural genomic 95.31
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 95.24
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 95.13
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 95.11
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 95.03
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 94.32
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 94.25
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 93.9
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 93.08
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 92.8
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 91.85
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 91.65
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 87.9
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 83.45
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.6e-65  Score=492.48  Aligned_cols=202  Identities=26%  Similarity=0.405  Sum_probs=179.3

Q ss_pred             cccccccccccCCCCCcccccc---C-------CeEEEEcCCccHHHHHHhHhhhHhhhcccCCCCCCCCCceEEEEEEE
Q 019766           19 CFSYHRHIYLLANDHQPCAFHL---G-------QVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIR   88 (336)
Q Consensus        19 ~f~~~~~~~~lp~~~~vc~y~~---~-------~I~k~~l~d~~~~~l~~rlq~f~l~FIe~aS~id~dd~~W~~f~lye   88 (336)
                      .++. ...|.+||. ++.+|+.   +       .||+++++||+++++|+|||+|++||||||||||.||++|++|++||
T Consensus       112 ~l~~-~~~f~P~G~-~v~~y~~~~~~~~~~~~feIy~~~~~~p~~~~~h~Rlq~f~l~FIE~as~id~dd~~W~~y~l~e  189 (324)
T 2p0w_A          112 LLEK-EVDFKPFGT-LLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFE  189 (324)
T ss_dssp             HHHT-GGGCCCCSE-EEEEEEECCTTSCCCEEEEEEEECTTSTTHHHHHHHHHHHHHHHSTTCCCCCTTCTTEEEEEEEE
T ss_pred             Hhcc-cccccCCCe-EEEEEEccCCCcccceEEEEEEEeCCCHHHHHHHHHHHHHHHHhEecccccCCCCCcEEEEEEEE
Confidence            3443 367888886 8888864   2       29999999999999999999999999999999999999999999999


Q ss_pred             eecCCCCCcceEEEEEeeeeeeccCCCCCCcceeeEEecCCCCCCChhhHHHHHHHHHh-hcCCceeeecCCCchhHHHh
Q 019766           89 KKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVA-VAENVHDFTVEEPLDSFQHV  167 (336)
Q Consensus        89 k~~~~~~~~~y~~vGy~T~Y~f~~yP~~~R~RISQ~LILPPyQ~~G~Gs~Ll~~iy~~~-~~~~V~EITVEDPse~F~~L  167 (336)
                      +.+. +|+.+|+++||+|+|+||+||+++|+|||||||||||||+|||++||++||+++ .+++|.|||||||||+||+|
T Consensus       190 k~~~-~~~~~y~~vGy~T~Y~f~~yp~~~R~RISQ~LILPPyQ~kG~G~~Ll~~iy~~~~~~~~v~eiTVEDPse~F~~L  268 (324)
T 2p0w_A          190 KYNK-DGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKL  268 (324)
T ss_dssp             EEEE-TTEEEEEEEEEEEEEEEEETTTEEEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHTCTTBCCBEESSCCHHHHHH
T ss_pred             EccC-CCCCceEEEEEEEEEEeeecCCcccceeEEEEEcCcccccCcHHHHHHHHHHHHhcCCCeEEEEEECChHHHHHH
Confidence            9754 577899999999999999999999999999999999999999999999999985 57899999999999999999


Q ss_pred             hhHHHHHHhhccchhhHhhhhhhhhcccCcccccccCCCCCCChHHHHHHHHHhCCchhHHHHHHHHHHHhhcC
Q 019766          168 RTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLD  241 (336)
Q Consensus       168 RD~vDl~~L~~~~~~~~~~~~~v~~l~~~~~~k~~~~~~~~~~~~~~e~~r~klKI~krQ~~Rv~Eilll~~l~  241 (336)
                      ||++|+++|.+++.+.+.      .+..|            .+++|++++|+|+||+||||+||||||+|..++
T Consensus       269 RD~~D~~~l~~l~~f~~~------~l~~~------------~~~~~~~~~r~k~KI~~rQ~~rv~Eil~l~~t~  324 (324)
T 2p0w_A          269 RDFVLVKLCQDLPCFSRE------KLMQG------------FNEDMAIEAQQKFKINKQHARRVYEILRLLVTD  324 (324)
T ss_dssp             HHHHHHHHHTTSGGGSHH------HHTTC------------CCHHHHHHHHHHHCBCHHHHHHHHHHHHHHSCC
T ss_pred             HHHHHHHHHhcCCcCCHh------HcCCC------------CCHHHHHHHHHHhCCCHHHHHHHHHHHHHhccC
Confidence            999999999987765432      12222            258999999999999999999999999998774
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 336
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 2e-47
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 3e-04
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 8e-04
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 0.001
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase HAT1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  160 bits (407), Expect = 2e-47
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 36/209 (17%)

Query: 42  QVVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRL 101
            V +  + +  A  ++ R+    LL ++ +N ID TDP W++Y L+ KK          L
Sbjct: 130 VVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKK-------TKEL 182

Query: 102 LGFTAIYRFYHY----------PDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVAVA-E 150
           +GF   Y+++HY              R ++SQ LI PPYQ KG+G  L E +    +  +
Sbjct: 183 IGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDK 242

Query: 151 NVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPP 210
           ++ + TVE+P ++F  +R   DIQ L                 K G  +           
Sbjct: 243 SITEITVEDPNEAFDDLRDRNDIQRL----------------RKLGYDAVFQKHSDL--S 284

Query: 211 ASTVEEVRKVLKINKKQFLQCWEILIYLR 239
              +E  RK LK+ ++QF +  E+L+ L 
Sbjct: 285 DEFLESSRKSLKLEERQFNRLVEMLLLLN 313
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 100.0
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 99.9
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 99.89
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 99.87
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 98.03
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 97.93
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 97.85
d1tiqa_173 Protease synthase and sporulation negative regulat 97.74
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 97.7
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 97.7
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 97.67
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 97.64
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 97.59
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 97.59
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 97.58
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 97.53
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 97.53
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 97.51
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 97.5
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 97.49
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 97.49
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 97.42
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 97.4
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 97.38
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 97.35
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 97.33
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 97.33
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 97.29
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 97.27
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 97.26
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 97.26
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 97.18
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 97.12
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 97.06
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 97.0
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 96.95
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 96.95
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 96.86
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 96.73
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 96.72
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 96.68
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 96.61
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 96.43
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 96.34
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 96.21
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 96.15
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 95.82
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 95.8
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 95.77
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 95.76
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 95.51
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 95.48
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 95.45
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 95.35
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 94.58
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 94.34
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 93.93
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 93.84
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 92.48
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 90.6
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 89.42
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 85.79
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase HAT1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1.9e-61  Score=463.53  Aligned_cols=189  Identities=30%  Similarity=0.483  Sum_probs=167.6

Q ss_pred             cccCCCCCccccccCC----eEEEEcCCccHHHHHHhHhhhHhhhcccCCCCCCCCCceEEEEEEEeecCCCCCcceEEE
Q 019766           27 YLLANDHQPCAFHLGQ----VVRMVVGNMEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLL  102 (336)
Q Consensus        27 ~~lp~~~~vc~y~~~~----I~k~~l~d~~~~~l~~rlq~f~l~FIe~aS~id~dd~~W~~f~lyek~~~~~~~~~y~~v  102 (336)
                      +..||+ .+.+|+.++    ||+++++||+++.+|+|||+|++|||||||+||.||++|++|++|++.+       ++++
T Consensus       112 f~p~g~-~v~~~~~~~~~feIy~~~l~~~~~~~~~~rlq~f~~~FIe~~S~Id~dD~~W~~~~~~ek~~-------~~~~  183 (315)
T d1boba_         112 LSDVFE-KVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKT-------KELI  183 (315)
T ss_dssp             TTTTSE-EEEEEEETTEEEEEEEECSCSHHHHHHHHHHTHHHHHHSTTCCCCCTTCTTEEEEEEEETTT-------CCEE
T ss_pred             CCCCce-EeeeeecCCceEEEEEEecCCHHHHHHHHHHHHHHHHHCcCCCccccCCCCEEEEEEEecCC-------Cccc
Confidence            444555 788898876    9999999999999999999999999999999999999999999999865       4799


Q ss_pred             EEeeeeeeccC----------CCCCCcceeeEEecCCCCCCChhhHHHHHHHHHh-hcCCceeeecCCCchhHHHhhhHH
Q 019766          103 GFTAIYRFYHY----------PDSTRMRLSQILILPPYQRKGYGGFLTEVLSNVA-VAENVHDFTVEEPLDSFQHVRTCV  171 (336)
Q Consensus       103 Gy~T~Y~f~~y----------P~~~R~RISQ~LILPPyQ~~G~Gs~Ll~~iy~~~-~~~~V~EITVEDPse~F~~LRD~v  171 (336)
                      ||+|+|+||+|          |+++|+|||||||||||||+|||++||++||+++ .+++|.|||||||||+||+|||++
T Consensus       184 Gy~T~Y~~~~Y~~~~~f~~~~~~~~R~RISQ~LILPPyQ~kG~G~~L~~~iy~~~~~d~~v~eiTVEDPse~F~~LRD~~  263 (315)
T d1boba_         184 GFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRN  263 (315)
T ss_dssp             EEEEEEEECCC---------CCCCEEEEEEEEEECGGGCSSSHHHHHHHHHHHHHHHCTTEEEEEESSCCHHHHHHHHHH
T ss_pred             ceeeeeeeeeccccccccccccccccceeEEEEEeCccccCCchHHHHHHHHHHHhcCCCeeeccccCChHHHHHHHHHH
Confidence            99999999999          7889999999999999999999999999999975 578999999999999999999999


Q ss_pred             HHHHhhccchhhHhhhhhhhhcccCcccccccCCCCCCChHHHHHHHHHhCCchhHHHHHHHHHHHhhcC
Q 019766          172 DIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLD  241 (336)
Q Consensus       172 Dl~~L~~~~~~~~~~~~~v~~l~~~~~~k~~~~~~~~~~~~~~e~~r~klKI~krQ~~Rv~Eilll~~l~  241 (336)
                      |+++|.+++.+..           ..+.       ...+++|++++|+++||+||||+||||||+|.+.+
T Consensus       264 D~~~l~~l~~~~~-----------~~~~-------~~~~~~~~~~~r~k~KI~~~Q~~rv~Eilll~~~~  315 (315)
T d1boba_         264 DIQRLRKLGYDAV-----------FQKH-------SDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS  315 (315)
T ss_dssp             HHHHHHHTTHHHH-----------TTCT-------TCCCHHHHHHHHHHHTBCHHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHhcCCcch-----------hhhc-------CCCCHHHHHHHHHHhCCCHHHHHHHHHHHHHhhcC
Confidence            9999987654321           0010       12368999999999999999999999999998653
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure