Citrus Sinensis ID: 019781

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccEEEEEEccccccEEEEEEEEcccccccccccEEEEccccccccccccccEEEEEEEccccEEEEEcccccccccccccEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************************LRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAH**************************************KIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYF******************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 3A subunit 2 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.probableA5PJN8
Splicing factor 3A subunit 2 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.probableQ15428
Splicing factor 3A subunit 2 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.probableQ6AXT8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DGW, chain C
Confidence level:very confident
Coverage over the Query: 126-207
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain B
Confidence level:probable
Coverage over the Query: 212-219
View the alignment between query and template
View the model in PyMOL
Template: 3EPH, chain A
Confidence level:probable
Coverage over the Query: 51-89
View the alignment between query and template
View the model in PyMOL