Citrus Sinensis ID: 019781

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccEEEEEEccccccEEEEEEEEcccccccccccEEEEccccccccccccccEEEEEEEccccEEEEEcccccccccccccEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHEEccccEEEEEEEEEcccccccHHHHccccHHHHHHHHHHHHHHHccccccccccccccccEEEEEccccEEEEEEEccccccEEEEEEEEcccccccccccEEEEEccHccccccccccEEEEEEEccccEEEEEEcccccccccccEEEEEcccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mdrewgskpgsggaasaqNEAIDRRERLRRLALETIdlakdpyfmrnhlgsyecKLCLTlhnnegnylahtqgkrHQTNLAKRAAReakdapaqpqphkrkvnvrktvkigrpgyrvtkqfdpetkqRSLLFQieypeiedlskprhrfmsSFEQRVQPFDKRYQYLMFAAEPYEiiafkvpsteidkstpkffshwdpdskmfTLQLYfkskpvegnkpqaapaangavapppppppqgpppgvsagnaprappppmtgtlppppppmangprpmppggappapppppggsgtmanftpgtqvgrpptmpppppqgyggqqmpirppppppnmgq
mdrewgskpgsggaasaqneaiDRRERLRRLALEtidlakdpyfmRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAReakdapaqpqphkrkvnvrktvkigrpgyrvtkqfdpetkqrslLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKStpkffshwdpdSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
MDREWgskpgsggaasaQNEAIDrrerlrrlaleTIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKpqaapaangavapppppppqgpppgvsagnaprappppmtgtlppppppmangprpmppggappapppppggSGTMANFTPGTQVGRpptmpppppqgyggqqmpIRppppppNMGQ
***************************LRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAH********************************************YRV***********SLLFQIEYPEIE************FEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYF******************************************************************************************************************************
*****************************RLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLA***************************************KIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYF******************************************************************************************************************************
*********************IDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAH*******************************VNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
*********************IDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKD*********RKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPV*****QA******AVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPP********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQGPPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTPGTQVGRPPTMPPPPPQGYGGQQMPIRPPPPPPNMGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query336 2.2.26 [Sep-21-2011]
Q15428 464 Splicing factor 3A subuni yes no 0.613 0.443 0.708 3e-75
Q6AXT8 471 Splicing factor 3A subuni yes no 0.613 0.437 0.708 3e-75
A5PJN8 477 Splicing factor 3A subuni yes no 0.613 0.431 0.708 5e-75
Q54B65215 Splicing factor 3A subuni yes no 0.613 0.958 0.602 4e-72
Q62203 475 Splicing factor 3A subuni yes no 0.583 0.412 0.689 7e-70
Q9P7L8217 Pre-mRNA-splicing factor yes no 0.580 0.898 0.523 2e-56
>sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens GN=SF3A2 PE=1 SV=2 Back     alignment and function desciption
 Score =  282 bits (721), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 146/206 (70%), Positives = 174/206 (84%)

Query: 6   GSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65
           G K GSGG AS+     DRRERLR+LALETID+ KDPYFM+NHLGSYECKLCLTLHNNEG
Sbjct: 8   GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEG 67

Query: 66  NYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPET 125
           +YLAHTQGK+HQTNLA+RAA+EAK+APAQP P K KV V+K VKIGRPGY+VTKQ D E 
Sbjct: 68  SYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEM 127

Query: 126 KQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFKVPSTE 185
            Q+SLLFQI+YPEI +   PRHRFMS++EQR++P D+R+QYL+ AAEPYE IAFKVPS E
Sbjct: 128 GQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSRE 187

Query: 186 IDKSTPKFFSHWDPDSKMFTLQLYFK 211
           IDK+  KF++HW+ ++K F LQ +FK
Sbjct: 188 IDKAEGKFWTHWNRETKQFFLQFHFK 213
Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.
Homo sapiens (taxid: 9606)
>sp|Q6AXT8|SF3A2_RAT Splicing factor 3A subunit 2 OS=Rattus norvegicus GN=Sf3a2 PE=2 SV=1 Back     alignment and function description
>sp|A5PJN8|SF3A2_BOVIN Splicing factor 3A subunit 2 OS=Bos taurus GN=SF3A2 PE=2 SV=1 Back     alignment and function description
>sp|Q54B65|SF3A2_DICDI Splicing factor 3A subunit 2 OS=Dictyostelium discoideum GN=sf3a2 PE=3 SV=1 Back     alignment and function description
>sp|Q62203|SF3A2_MOUSE Splicing factor 3A subunit 2 OS=Mus musculus GN=Sf3a2 PE=2 SV=2 Back     alignment and function description
>sp|Q9P7L8|SAP62_SCHPO Pre-mRNA-splicing factor sap62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap62 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
224140247334 predicted protein [Populus trichocarpa] 0.985 0.991 0.811 1e-122
297739988241 unnamed protein product [Vitis vinifera] 0.699 0.975 0.931 1e-120
255556836327 Splicing factor 3A subunit, putative [Ri 0.949 0.975 0.827 1e-120
449501030341 PREDICTED: splicing factor 3A subunit 2- 0.684 0.674 0.943 1e-119
449440151341 PREDICTED: splicing factor 3A subunit 2- 0.684 0.674 0.943 1e-119
225441145357 PREDICTED: splicing factor 3A subunit 2 0.687 0.647 0.939 1e-119
356554761349 PREDICTED: splicing factor 3A subunit 2- 0.684 0.659 0.934 1e-117
356550634350 PREDICTED: splicing factor 3A subunit 2- 0.684 0.657 0.930 1e-117
262192723253 hypothetical protein [Nicotiana tabacum] 0.672 0.893 0.902 1e-114
116787560308 unknown [Picea sitchensis] 0.687 0.75 0.891 1e-111
>gi|224140247|ref|XP_002323495.1| predicted protein [Populus trichocarpa] gi|222868125|gb|EEF05256.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 288/339 (84%), Gaps = 8/339 (2%)

Query: 1   MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL 60
           MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL
Sbjct: 1   MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL 60

Query: 61  HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQ 120
           HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPA PQP+KRKVN+RKTVKIGRPGYRVTKQ
Sbjct: 61  HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPALPQPNKRKVNIRKTVKIGRPGYRVTKQ 120

Query: 121 FDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFK 180
           FDPETKQRSLLFQIEYPEIED +KPRHRFMSS+EQR++  DKR+QYL+F+AEPYEIIAFK
Sbjct: 121 FDPETKQRSLLFQIEYPEIEDNTKPRHRFMSSYEQRIEANDKRFQYLLFSAEPYEIIAFK 180

Query: 181 VPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNKPQAAPAANGAVAPPPPPPPQG 240
           VPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK KP E NKPQ+  AAN  V   PPPP   
Sbjct: 181 VPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKLKPPEANKPQSVAAANSTVPSQPPPPLPP 240

Query: 241 PPPGVSAGNAPRAPPPPMTGTLPPPPPPMANGPRPMPPGGAPPAPPPPPGGSGTMANFTP 300
                    +   PPP      PPPPP MANGPRPMPPGGAPPAPPPPPGGSG M NFTP
Sbjct: 241 QG---LPAGSRPPPPPMPASLPPPPPPAMANGPRPMPPGGAPPAPPPPPGGSGAMVNFTP 297

Query: 301 GTQVGRPPTMPPPPPQGYGGQQM---PIRPPPPPPNMGQ 336
           GTQ GRP +M   PP G+ GQQM    IRPP  PPNMGQ
Sbjct: 298 GTQAGRPSSM--LPPHGFLGQQMQGQTIRPPLLPPNMGQ 334

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739988|emb|CBI30170.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556836|ref|XP_002519451.1| Splicing factor 3A subunit, putative [Ricinus communis] gi|223541314|gb|EEF42865.1| Splicing factor 3A subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449501030|ref|XP_004161259.1| PREDICTED: splicing factor 3A subunit 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440151|ref|XP_004137848.1| PREDICTED: splicing factor 3A subunit 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225441145|ref|XP_002266748.1| PREDICTED: splicing factor 3A subunit 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554761|ref|XP_003545711.1| PREDICTED: splicing factor 3A subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356550634|ref|XP_003543690.1| PREDICTED: splicing factor 3A subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|262192723|gb|ACY30431.1| hypothetical protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|116787560|gb|ABK24557.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
TAIR|locus:2060279277 AT2G32600 [Arabidopsis thalian 0.651 0.790 0.789 1.1e-92
ZFIN|ZDB-GENE-040426-897278 sf3a2 "splicing factor 3a, sub 0.526 0.636 0.717 1.8e-69
UNIPROTKB|A5PJN8 477 SF3A2 "Splicing factor 3A subu 0.535 0.377 0.712 4.9e-69
UNIPROTKB|G3MW14411 SF3A2 "Splicing factor 3A subu 0.535 0.437 0.712 4.9e-69
UNIPROTKB|J9P6E2 478 SF3A2 "Uncharacterized protein 0.535 0.376 0.712 4.9e-69
UNIPROTKB|Q15428 464 SF3A2 "Splicing factor 3A subu 0.535 0.387 0.712 4.9e-69
RGD|1308627 471 Sf3a2 "splicing factor 3a, sub 0.535 0.382 0.712 4.9e-69
FB|FBgn0036314264 CG10754 [Drosophila melanogast 0.535 0.681 0.657 7.6e-64
WB|WBGene00008683222 repo-1 [Caenorhabditis elegans 0.523 0.792 0.666 1.6e-63
UNIPROTKB|Q19335222 repo-1 "Protein REPO-1" [Caeno 0.523 0.792 0.666 1.6e-63
TAIR|locus:2060279 AT2G32600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 923 (330.0 bits), Expect = 1.1e-92, P = 1.1e-92
 Identities = 173/219 (78%), Positives = 184/219 (84%)

Query:     1 MDREWXXXXXXXXXXXXQNEAIDXXXXXXXXXXXTIDLAKDPYFMRNHLGSYECKLCLTL 60
             MDREW            QNEAID           TIDLAKDPYFMRNHLGSYECKLCLTL
Sbjct:     1 MDREWGSKPGSGGAASGQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL 60

Query:    61 HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQ 120
             HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAP +PQP KR V+VR+TVKIGRPGYRVTKQ
Sbjct:    61 HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPTKPQPLKRNVSVRRTVKIGRPGYRVTKQ 120

Query:   121 FDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAFK 180
             +DPE +QRSLLFQIEYPEIED  KPRHRFMSS+EQ+VQP+DK YQYL+FAAEPYEIIAFK
Sbjct:   121 YDPELQQRSLLFQIEYPEIEDNIKPRHRFMSSYEQKVQPYDKSYQYLLFAAEPYEIIAFK 180

Query:   181 VPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVEGNK 219
             VPSTE+DKSTPKFFSHWDPDSKMFTLQ+YFK    E NK
Sbjct:   181 VPSTEVDKSTPKFFSHWDPDSKMFTLQVYFKPTKPEPNK 219
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0051604 "protein maturation" evidence=RCA
ZFIN|ZDB-GENE-040426-897 sf3a2 "splicing factor 3a, subunit 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJN8 SF3A2 "Splicing factor 3A subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MW14 SF3A2 "Splicing factor 3A subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6E2 SF3A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15428 SF3A2 "Splicing factor 3A subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308627 Sf3a2 "splicing factor 3a, subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0036314 CG10754 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00008683 repo-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q19335 repo-1 "Protein REPO-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15428SF3A2_HUMANNo assigned EC number0.70870.61300.4439yesno
Q54B65SF3A2_DICDINo assigned EC number0.60280.61300.9581yesno
A5PJN8SF3A2_BOVINNo assigned EC number0.70870.61300.4318yesno
Q6AXT8SF3A2_RATNo assigned EC number0.70870.61300.4373yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0025001901
hypothetical protein (334 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_XIII3357
hypothetical protein (820 aa)
    ••• 0.636
eugene3.00170116
hypothetical protein (1268 aa)
    ••• 0.613
eugene3.00440042
hypothetical protein (2357 aa)
    ••• 0.572
eugene3.00120183
hypothetical protein (509 aa)
    ••• 0.471
gw1.XV.452.1
hypothetical protein (495 aa)
    ••• 0.470
fgenesh4_pm.C_LG_V000144
hypothetical protein (776 aa)
    ••• 0.450
eugene3.00070768
hypothetical protein (795 aa)
    ••• 0.428
gw1.XI.1022.1
SubName- Full=Putative uncharacterized protein; (240 aa)
    ••  0.401

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
COG5246222 COG5246, PRP11, Splicing factor 3a, subunit 2 [RNA 2e-65
smart01050129 smart01050, CactinC_cactus, Cactus-binding C-termi 4e-19
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-10
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-09
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 3e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-08
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 4e-08
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 8e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
pfam04652315 pfam04652, DUF605, Vta1 like 1e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-07
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-07
pfam1287425 pfam12874, zf-met, Zinc-finger of C2H2 type 7e-07
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 8e-07
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-06
pfam04652315 pfam04652, DUF605, Vta1 like 5e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-05
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 1e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 1e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-05
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 5e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 7e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 8e-05
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 9e-05
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 9e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-04
PRK13729 475 PRK13729, PRK13729, conjugal transfer pilus assemb 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-04
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 3e-04
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 4e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 5e-04
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 5e-04
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 5e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 6e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.002
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.002
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
TIGR02784 1135 TIGR02784, addA_alphas, double-strand break repair 0.002
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.002
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.002
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 0.002
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.002
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.002
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 0.003
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.003
PHA03291401 PHA03291, PHA03291, envelope glycoprotein I; Provi 0.003
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 0.003
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 0.004
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 0.004
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.004
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.004
>gnl|CDD|227571 COG5246, PRP11, Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information 
 Score =  205 bits (523), Expect = 2e-65
 Identities = 74/212 (34%), Positives = 114/212 (53%), Gaps = 8/212 (3%)

Query: 6   GSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65
           GSK G GG AS   +   RR R   L     DL  DPY  +NH G Y C LC T H  E 
Sbjct: 8   GSKTGGGGTASEIKKNKKRRSRQLLLEAYGQDLMDDPYLSKNHTGKYVCLLCKTKHLTEM 67

Query: 66  NYLAHTQGKRHQTNLAKRAAREAKDAP-AQPQPHKRK----VNVRKTV-KIGRPGYRVTK 119
           +Y+ H +GK+H+ N ++R+  ++      Q     R+    +  ++++ + G P Y+V  
Sbjct: 68  SYVKHREGKKHKENSSRRSEEKSSLGRENQTTHDFRQQQKIIEAKQSLKRSGIPSYKVRS 127

Query: 120 QFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYEIIAF 179
             +P+  +R L  Q+ Y +      P++R +SS EQ V+ +D+ ++YL+FA EPYE IAF
Sbjct: 128 LVEPKGGRRGLGIQVNYEDDLAEEMPQYRIVSSLEQNVEEYDESFRYLVFACEPYENIAF 187

Query: 180 KVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK 211
           K  + EID  +      WD ++  +TLQ +F 
Sbjct: 188 KFENKEIDFLSIYED--WDAETGTYTLQFFFL 217

Length = 222
>gnl|CDD|214996 smart01050, CactinC_cactus, Cactus-binding C-terminus of cactin protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234012 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 336
KOG0227222 consensus Splicing factor 3a, subunit 2 [RNA proce 100.0
COG5246222 PRP11 Splicing factor 3a, subunit 2 [RNA processin 100.0
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 99.59
PF09732125 CactinC_cactus: Cactus-binding C-terminus of cacti 99.44
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.79
KOG3671 569 consensus Actin regulatory protein (Wiskott-Aldric 98.31
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.03
KOG4727193 consensus U1-like Zn-finger protein [General funct 97.73
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.52
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.36
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 96.26
KOG3671 569 consensus Actin regulatory protein (Wiskott-Aldric 95.66
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 95.43
KOG2370623 consensus Cactin [Signal transduction mechanisms] 95.35
KOG0150336 consensus Spliceosomal protein FBP21 [RNA processi 92.3
KOG3032264 consensus Uncharacterized conserved protein [Funct 92.17
PLN02748468 tRNA dimethylallyltransferase 91.33
KOG3454165 consensus U1 snRNP-specific protein C [RNA process 91.15
KOG4722672 consensus Zn-finger protein [General function pred 90.47
KOG4672 487 consensus Uncharacterized conserved low complexity 90.32
PHA03247 3151 large tegument protein UL36; Provisional 90.18
PHA03247 3151 large tegument protein UL36; Provisional 89.53
KOG1830 518 consensus Wiskott Aldrich syndrome proteins [Cytos 89.02
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 85.66
PF05477244 SURF2: Surfeit locus protein 2 (SURF2); InterPro: 83.31
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 80.57
>KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=5.7e-94  Score=646.74  Aligned_cols=216  Identities=69%  Similarity=1.101  Sum_probs=209.3

Q ss_pred             CCCCCCCCCCCccccchhhhHHHHHHHHHHHhhhhcCCCCCcceeeccCCceeeeccccccCCccccccccchhhHHHHH
Q 019781            1 MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNL   80 (336)
Q Consensus         1 ~~~~~GsK~G~Gg~As~~~~n~~rrerl~~L~~e~id~~~dPy~~rNh~G~yeC~LClt~h~~e~syl~H~qGkkHq~nL   80 (336)
                      |.+|+|||+|||||||+||.|+|||||||+||+|+|||++||||||||+|+|||+||+|+|+||+||++||||||||+||
T Consensus         3 ~~~r~GsK~G~ggvAS~se~n~~RrerlrqLaletidl~kDPy~mkNh~G~yeCkLClT~H~ne~Syl~HtqGKKHq~Nl   82 (222)
T KOG0227|consen    3 YQNRAGSKTGSGGVASESEFNRDRRERLRQLALETIDLNKDPYFMKNHLGKYECKLCLTLHNNEGSYLAHTQGKKHQTNL   82 (222)
T ss_pred             cccccCccCCCCcccchhhhhHHHHHHHHHHHHhhcccccCchhhhccCcceeehhhhhhhcchhhhhhhhccchhhHHH
Confidence            56899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcCCCCCCCcccccccccceecCCCceeEEEeeCCCcCccceEEEEecccccccCCcccccccchhhccccc
Q 019781           81 AKRAAREAKDAPAQPQPHKRKVNVRKTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPF  160 (336)
Q Consensus        81 ~rR~a~~~k~~~~~~~~~~~~~~~r~~vkigrPgykVtk~rDPet~q~gllfqIdyp~i~d~~~P~~RiMSa~EqKvEel  160 (336)
                      +||+|+|+|++....++.+..+++|++||||||||||||||||+.+|++|+|||||++|+++++|+|||||++||++|..
T Consensus        83 arraa~e~k~s~~~~~~~k~~v~vk~~vkigrpgykvtk~r~~~~gq~~L~fQv~Yp~i~~~~~Pr~rfmssyeq~ve~~  162 (222)
T KOG0227|consen   83 ARRAAKEAKESPDLPQPQKIIVEVKKFVKIGRPGYKVTKQRDPENGQQGLLFQVNYPEIEEGIMPRHRFMSSYEQKVEPP  162 (222)
T ss_pred             HHHHHHHhhcCccccccccchhhhhhhhhcCCCcceeeeeecCccCceeeEEEecchhhhhccCCcchhhhhhHhhcCCc
Confidence            99999999999877777666789999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccceeeeeecccccccccccCcccccCCCcccccccCCCceEEEEEeeccCCCC
Q 019781          161 DKRYQYLMFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPVE  216 (336)
Q Consensus       161 dkk~qyLliA~EPyEtIa~kIPn~eId~~~~~~~~~WD~d~K~f~lQf~Fk~~~~e  216 (336)
                      |+++|||+||+||||+|+|||||+|||++++|||||||.+||+||||||||....+
T Consensus       163 dk~~qyLvfaaePyE~Iafk~p~~Eid~se~Kf~t~wd~~tk~y~lqF~fk~~~~~  218 (222)
T KOG0227|consen  163 DKSWQYLVFAAEPYENIAFKVPSREIDKSEGKFWTHWDAETKQYTLQFFFKQAEPE  218 (222)
T ss_pred             cccceEEEEEeccccceeeecCchhhhhccCceeeeecCCCceEEEEEEecccCcc
Confidence            99999999999999999999999999999999999999999999999999976554

>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF09732 CactinC_cactus: Cactus-binding C-terminus of cactin protein; InterPro: IPR019134 This entry represents the C-terminal 200 residues of the cactin protein which is necessary for the association of cactin with IkappaB-cactus, as one of the intracellular members of the Rel complex Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2370 consensus Cactin [Signal transduction mechanisms] Back     alignment and domain information
>KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] Back     alignment and domain information
>KOG3032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] Back     alignment and domain information
>KOG4722 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF05477 SURF2: Surfeit locus protein 2 (SURF2); InterPro: IPR008833 Surfeit locus protein 2 is part of a group of at least six sequence unrelated genes (Surf-1 to Surf-6) Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
4dgw_C231 PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A 4e-51
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-15
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-12
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-09
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 7e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 2e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 2e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 8e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 3e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 1e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 8e-04
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-04
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 8e-04
>4dgw_C PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 231 Back     alignment and structure
 Score =  168 bits (426), Expect = 4e-51
 Identities = 29/120 (24%), Positives = 47/120 (39%), Gaps = 20/120 (16%)

Query: 111 GRPGYRVTKQFDPETKQRSLLFQIEYPEIEDLSKPRHRFMSSFEQRVQPFDKRYQYLMFA 170
           G  G  +   +  E K+ S+       + +    P  R +S  E       K  ++L+ A
Sbjct: 114 GSVGMAIQVNYSSEVKENSVD-----SDDKAKVPPLIRIVSGLELSDTK-QKGKKFLVIA 167

Query: 171 AEPYEIIAFKVPSTEIDKSTPKF--------------FSHWDPDSKMFTLQLYFKSKPVE 216
            EP+E IA ++P  EI  S                   + WD  SK++ +Q +FK    E
Sbjct: 168 YEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQE 227
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
4dgw_C231 PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A 100.0
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.97
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.74
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 96.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.08
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 93.83
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 81.26
>4dgw_C PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.3e-41  Score=308.55  Aligned_cols=106  Identities=25%  Similarity=0.361  Sum_probs=96.5

Q ss_pred             cceecCCCceeEEEeeCCCcCccceEEEEeccc-c---------cccCCcccccccchhhcccccccccceeeeeecccc
Q 019781          106 KTVKIGRPGYRVTKQFDPETKQRSLLFQIEYPE-I---------EDLSKPRHRFMSSFEQRVQPFDKRYQYLMFAAEPYE  175 (336)
Q Consensus       106 ~~vkigrPgykVtk~rDPet~q~gllfqIdyp~-i---------~d~~~P~~RiMSa~EqKvEeldkk~qyLliA~EPyE  175 (336)
                      ....||||||||||||||+|+|+||+|||+|++ |         .++++|+|||||+|||++|+. +++|||+||+||||
T Consensus        94 ~~~~IGRPGYKVTKVRDPETgQ~GLLFQVdYPEeIk~~~~~~~~~egi~PrhRIMSAyEQrVE~P-Kd~QYLVIAAEPYE  172 (231)
T 4dgw_C           94 XXXXXXXXXXXXXXXXXXXXGSVGMAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQ-KGKKFLVIAYEPFE  172 (231)
T ss_dssp             HSCCCCCCCCBCCCEECCBCCBCCEEEEEECCCSSSTTSCCSCSSTTCCCEEEEEETTCCSSCCC-CCCEEEEEECSSSC
T ss_pred             cccccccccccccccccccCCCeeEEEEEECChhhhhcccccccCCCCCcCEEEECHHHhcccCC-CCCEEEEEEeCCCC
Confidence            456899999999999999999999999999998 5         577999999999999999988 99999999999999


Q ss_pred             cccccccCcccccCC--------------CcccccccCCCceEEEEEeecc
Q 019781          176 IIAFKVPSTEIDKST--------------PKFFSHWDPDSKMFTLQLYFKS  212 (336)
Q Consensus       176 tIa~kIPn~eId~~~--------------~~~~~~WD~d~K~f~lQf~Fk~  212 (336)
                      +|+|||||+|||+.+              ++||||||+|+|+|+||||||.
T Consensus       173 TIAFKIPNrEIDk~e~~~~~~~~~svDElgKfwTyWD~DsK~FyLQffFK~  223 (231)
T 4dgw_C          173 NIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQ  223 (231)
T ss_dssp             CBCCEECSSCSSCCSCCSCCCCCCSSCHHHHHTEEEETTTTEEEEC-----
T ss_pred             CceeEcCChhhccccccccccccccccccCCEEEEecCCCCEEEEEEEEee
Confidence            999999999999988              7899999999999999999994
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 97.02
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 96.75
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.42
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 94.75
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 81.04
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 80.78
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: dsRNA-binding protein ZFa (ZNF346, JAZ)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=97.02  E-value=7e-05  Score=53.68  Aligned_cols=32  Identities=28%  Similarity=0.354  Sum_probs=30.2

Q ss_pred             eeeccccccCCccccccccchhhHHHHHHHHH
Q 019781           53 ECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRA   84 (336)
Q Consensus        53 eC~LClt~h~~e~syl~H~qGkkHq~nL~rR~   84 (336)
                      -|.||+.+-++-...++|-+||+|.+||++|.
T Consensus        23 ~C~lCn~~Fns~~~AqsHY~GK~H~K~lk~~~   54 (55)
T d1zu1a2          23 CCPVCNMTFSSPVVAESHYIGKTHIKNLRLRE   54 (55)
T ss_dssp             EETTTTEECSSHHHHHHHHTSHHHHHHHHHHH
T ss_pred             hhhhhhcccCCHHHHHHHhhhhHHHHHHHHhc
Confidence            69999999999999999999999999999763
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure