Citrus Sinensis ID: 019800

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----

MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLGGNMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYSREMHTGDALPVSPGASEAAKPRRYKRAKEPKVLSPNKKTAKSPRKVKRENEDLNKVVFGKPSEWKSVQDLDGGDDDVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK

cccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHcccccEEEEc

********************************************ALQE****************MAFLQRDTAIAERNNAILERDNAIASL***************************************************************************************************************************************GQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVP*************GSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNAIASLQYRENSLGGNMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYSREMHTGDALPVSPGASEAAKPRRYKRAKEPKVLSPNKKTAKSPRKVKRENEDLNKVVFGKPSEWKSVQDLDGGDDDVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Barley B recombinant-like protein D	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	probable	Q5VSA8
Protein BASIC PENTACYSTEINE6	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	probable	Q8L999

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 39-56
View the alignment between query and template
View the model in PyMOL