Citrus Sinensis ID: 019836


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
MLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWFELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFDLRAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL
ccccccccccccccccccccccccEEEEEECccccEEEEEEEcccccCEEEEEECccccccCEEEEEcccEEEEECccEEEcHHHHHHcccCEEEECccccCEEEEEEccccccccEEEEEccccEEEEEEccccccccEEEEEEEECcccccccccccccccccccccEEEEEEEEcccccEEEEECccccccccCCccccccccccEEEEEEEccccccccEEEEccccccccccEEEECcccEEEEEEcccccCCcccEEECcccccccccccCEEEEEEEEccccEEEEEEEEccccccccEEEEEcccccccccccccccHHHHHHHHcc
MLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWFELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFDLRAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEE*AK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWFELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFDLRAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carotenoid 9,10(9',10')-cleavage dioxygenase 1 Cleaves a variety of carotenoids symmetrically at both the 9-10 and 9'-10' double bonds. Active on beta,beta-carotene, lutein, zeaxanthin, all-trans-violaxanthin, 9-cis-violaxanthin and 9'-cis-neoxanthin. With most substrates, the carotenoid is symmetrically cleaved. Probably not involved in abscisic acid biosynthesis.probableO65572
Carotenoid 9,10(9',10')-cleavage dioxygenase 1 Cleaves a variety of carotenoids at the 9-10 and 9'-10' double bonds. Probably not involved in abscisic acid biosynthesis.probableQ94IR2
Carotenoid 9,10(9',10')-cleavage dioxygenase Cleaves a variety of carotenoids symmetrically at both the 9-10 and 9'-10' double bonds. Catalyzes the formation of 4,9-dimethyldodeca-2,4,6,8,10-pentaene-1,12-dialdehyde and probably hydroxydihydro-beta-ionone from zeaxanthin.probableQ84KG5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.99.-Miscellaneous (requires further characterization).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NPE, chain A
Confidence level:very confident
Coverage over the Query: 2-234,248-333
View the alignment between query and template
View the model in PyMOL