Citrus Sinensis ID: 019860

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----

MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM

cEEEEEEcccccccccccccccCEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHcccccccccccccccEEEccccc

MLILETHSLRNTDASFSESLYGLRRRSV************************RQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWG********************************TSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQE******************LLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQ**********************************TICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxisome biogenesis protein 12	Required for peroxisome biogenesis and for PTS1- and PTS2-dependent protein import into peroxisomes. Essential for the peroxisomal targeting of PEX7. Required for the export/release of receptors on the peroxisome membrane. May act as a E3 ubiquitin-protein ligase involved in monoubiquitination of PEX5.	confident	Q9M841

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NG2, chain A
Confidence level:confident
Coverage over the Query: 275-332
View the alignment between query and template
View the model in PyMOL