Citrus Sinensis ID: 019860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
cEEEEEEcccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHcccccccccccccccEEEccccc
cEEEEEEEEEccccccHHHccccEEEcccccccccHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccccccEEccccEEEEHHHHHHHHHHccccccccccccHHHHHHHHHcc
mlilethslrntdasfseslyglrrRSVRIrakkddtrlkssdgihhsglEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQAslwgptderfddvdyfggggnplfsrggtdaetSVRTSLTKKIQKIIFACYpwlhasceglSFTYQLLYLLDATGFYSVGLHALGIHVCRATgqelmdnssrISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEErmsaptvypppppppppkvaregiplppdrticplcsqkranpsvvTVSGFVFCYACIFKYVsqykrcpvtlmpATVEQIRRLFHDM
mlilethslrntdasfseslyglrrrsvrirakkddtrlkssdgihhsglekrqrVLSVVFMVVLPYFKSKLHSVYNKEREARLqaslwgptdeRFDDVDYFGGGGnplfsrggtdaeTSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRAtgqelmdnssriskirsrererllgplWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNssriskirsrererLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYpppppppppKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
****************************************************RQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGT***TSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQE*****************RLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQ**********************************TICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLF***
MLILETHSLRNTDASFSESLYGLRRRSV*************************QRVLSVVFMVVLPYFKSKLHSVYNKEREA****************************************TSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRA***************************WLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMME***************************************ICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGG***********TKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
MLILETHSLRNTDASFSESLYGLRRRSV********************GLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWG***************************ETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNSSRISKI*******LLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEER*S******PPPPPPPP***REGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query334 2.2.26 [Sep-21-2011]
Q9M841393 Peroxisome biogenesis pro yes no 0.997 0.847 0.747 1e-144
Q54N40459 Putative peroxisome assem yes no 0.601 0.437 0.393 4e-31
O88177359 Peroxisome assembly prote yes no 0.850 0.791 0.299 2e-29
O00623359 Peroxisome assembly prote yes no 0.838 0.779 0.295 2e-29
A4FUD4359 Peroxisome assembly prote yes no 0.853 0.793 0.294 3e-29
Q8VC48359 Peroxisome assembly prote yes no 0.850 0.791 0.296 8e-29
Q9ET67359 Peroxisome assembly prote N/A no 0.850 0.791 0.296 1e-28
Q19189359 Putative peroxisome assem yes no 0.823 0.766 0.243 6e-25
Q01961409 Peroxisome assembly prote yes no 0.832 0.679 0.232 3e-12
C8VCP8489 Peroxisome assembly prote yes no 0.874 0.597 0.241 3e-11
>sp|Q9M841|PEX12_ARATH Peroxisome biogenesis protein 12 OS=Arabidopsis thaliana GN=PEX12 PE=1 SV=2 Back     alignment and function desciption
 Score =  511 bits (1317), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 249/333 (74%), Positives = 284/333 (85%)

Query: 1   MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVV 60
           MLILE HSLR TD SF+ESLYGLRR+S R+R +KD  R  SS+ + HSGLEKRQR+LSVV
Sbjct: 60  MLILEGHSLRTTDGSFAESLYGLRRKSARLRLRKDSARKDSSEEVQHSGLEKRQRILSVV 119

Query: 61  FMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETS 120
           F+VVLPYFKSKLH++YNKEREARL+ SLWG  D+ FD+ D+F G  + +      + E S
Sbjct: 120 FLVVLPYFKSKLHAIYNKEREARLRESLWGAEDQGFDEADFFTGDDSIVSREPSGNEELS 179

Query: 121 VRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQ 180
           VR  L  KI+K I  CYPW+HAS EGLSFTYQLLYLLDATGFYS+GL ALGI VCRATGQ
Sbjct: 180 VRVQLATKIKKFIAVCYPWIHASSEGLSFTYQLLYLLDATGFYSLGLQALGIQVCRATGQ 239

Query: 181 ELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEW 240
           ELMD SSRISKIR+ ERERL GP WLK +QGALLSC+Y +LDYAQTGLIAAVF FKMMEW
Sbjct: 240 ELMDTSSRISKIRNHERERLRGPPWLKTVQGALLSCSYAVLDYAQTGLIAAVFIFKMMEW 299

Query: 241 WYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVF 300
           WYQSAEER+SAPTVYPPPPPPP PK+A+EGIPLPPDR++C LC QKRANPSVVTVSGFVF
Sbjct: 300 WYQSAEERLSAPTVYPPPPPPPAPKMAKEGIPLPPDRSLCALCLQKRANPSVVTVSGFVF 359

Query: 301 CYACIFKYVSQYKRCPVTLMPATVEQIRRLFHD 333
           CY+C+FKYVS+YKRCPVTL+PA+V+QIRRLF D
Sbjct: 360 CYSCVFKYVSKYKRCPVTLIPASVDQIRRLFQD 392
Required for peroxisome biogenesis and for PTS1- and PTS2-dependent protein import into peroxisomes. Essential for the peroxisomal targeting of PEX7. Required for the export/release of receptors on the peroxisome membrane. May act as a E3 ubiquitin-protein ligase involved in monoubiquitination of PEX5.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54N40|PEX12_DICDI Putative peroxisome assembly protein 12 OS=Dictyostelium discoideum GN=pex12 PE=3 SV=1 Back     alignment and function description
>sp|O88177|PEX12_RAT Peroxisome assembly protein 12 OS=Rattus norvegicus GN=Pex12 PE=2 SV=1 Back     alignment and function description
>sp|O00623|PEX12_HUMAN Peroxisome assembly protein 12 OS=Homo sapiens GN=PEX12 PE=1 SV=1 Back     alignment and function description
>sp|A4FUD4|PEX12_BOVIN Peroxisome assembly protein 12 OS=Bos taurus GN=PEX12 PE=2 SV=1 Back     alignment and function description
>sp|Q8VC48|PEX12_MOUSE Peroxisome assembly protein 12 OS=Mus musculus GN=Pex12 PE=2 SV=1 Back     alignment and function description
>sp|Q9ET67|PEX12_CRILO Peroxisome assembly protein 12 OS=Cricetulus longicaudatus GN=PEX12 PE=2 SV=1 Back     alignment and function description
>sp|Q19189|PEX12_CAEEL Putative peroxisome assembly protein 12 OS=Caenorhabditis elegans GN=prx-12 PE=3 SV=1 Back     alignment and function description
>sp|Q01961|PEX12_PICPA Peroxisome assembly protein 12 OS=Komagataella pastoris GN=PEX12 PE=3 SV=1 Back     alignment and function description
>sp|C8VCP8|PEX12_EMENI Peroxisome assembly protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=PEX12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
224125722393 predicted protein [Populus trichocarpa] 1.0 0.849 0.829 1e-158
224145814388 predicted protein [Populus trichocarpa] 0.985 0.847 0.823 1e-156
255561963393 conserved hypothetical protein [Ricinus 1.0 0.849 0.811 1e-153
225465593393 PREDICTED: peroxisome biogenesis protein 1.0 0.849 0.820 1e-152
219688708393 peroxin 12 [Nicotiana tabacum] 1.0 0.849 0.775 1e-147
449470218393 PREDICTED: peroxisome biogenesis protein 1.0 0.849 0.769 1e-147
297828938393 peroxin-12 [Arabidopsis lyrata subsp. ly 0.997 0.847 0.750 1e-143
42563493393 peroxin-12 [Arabidopsis thaliana] gi|209 0.997 0.847 0.747 1e-142
356505983386 PREDICTED: peroxisome biogenesis protein 0.979 0.847 0.742 1e-131
356573139377 PREDICTED: peroxisome biogenesis protein 0.952 0.843 0.745 1e-130
>gi|224125722|ref|XP_002319659.1| predicted protein [Populus trichocarpa] gi|222858035|gb|EEE95582.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/334 (82%), Positives = 296/334 (88%)

Query: 1   MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVV 60
           ML+LETHSLR TDASF+ESLYGLRRR+V+IR KK+D R KS DGI HSGLEK QR+LSVV
Sbjct: 60  MLVLETHSLRTTDASFAESLYGLRRRAVKIRVKKEDARPKSGDGIQHSGLEKHQRILSVV 119

Query: 61  FMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETS 120
           F+VVLPYFKSKLHS+YNKEREARLQASLWG  DE  +D +YF GG   L S    DAE +
Sbjct: 120 FLVVLPYFKSKLHSIYNKEREARLQASLWGNGDETVEDAEYFSGGDASLVSGETLDAEAT 179

Query: 121 VRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQ 180
           +R  LTKKIQKI+F+CYPWLHAS EG+SF YQLLYLLDATGFYS GLHALGIHVCRATGQ
Sbjct: 180 IRARLTKKIQKIVFSCYPWLHASSEGMSFAYQLLYLLDATGFYSFGLHALGIHVCRATGQ 239

Query: 181 ELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEW 240
           ELMD SSRISKIRS ER+RL GP WLK  QGALLSCAYTMLDYAQTGLIAAVF FKMMEW
Sbjct: 240 ELMDTSSRISKIRSNERDRLRGPPWLKTFQGALLSCAYTMLDYAQTGLIAAVFIFKMMEW 299

Query: 241 WYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVF 300
           WYQSAEERMSAPTVYPPPPPPPPPKVA+EGIPLPPDRTICPLCSQ RANPSVVT+SGFVF
Sbjct: 300 WYQSAEERMSAPTVYPPPPPPPPPKVAKEGIPLPPDRTICPLCSQMRANPSVVTISGFVF 359

Query: 301 CYACIFKYVSQYKRCPVTLMPATVEQIRRLFHDM 334
           CYACIFKYVSQY RCPVTLMPA V+ IRRLFHDM
Sbjct: 360 CYACIFKYVSQYNRCPVTLMPANVDHIRRLFHDM 393

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224145814|ref|XP_002325774.1| predicted protein [Populus trichocarpa] gi|222862649|gb|EEF00156.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561963|ref|XP_002521990.1| conserved hypothetical protein [Ricinus communis] gi|223538794|gb|EEF40394.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225465593|ref|XP_002264983.1| PREDICTED: peroxisome biogenesis protein 12 [Vitis vinifera] gi|302143588|emb|CBI22341.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|219688708|dbj|BAH09867.1| peroxin 12 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|449470218|ref|XP_004152815.1| PREDICTED: peroxisome biogenesis protein 12-like [Cucumis sativus] gi|449477734|ref|XP_004155107.1| PREDICTED: peroxisome biogenesis protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297828938|ref|XP_002882351.1| peroxin-12 [Arabidopsis lyrata subsp. lyrata] gi|297328191|gb|EFH58610.1| peroxin-12 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42563493|ref|NP_187096.2| peroxin-12 [Arabidopsis thaliana] gi|209572659|sp|Q9M841.2|PEX12_ARATH RecName: Full=Peroxisome biogenesis protein 12; AltName: Full=Peroxin-12; Short=AtPEX12; AltName: Full=Pex12p; AltName: Full=Protein ABERRANT PEROXISOME MORPHOLOGY 4 gi|332640564|gb|AEE74085.1| peroxin-12 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356505983|ref|XP_003521768.1| PREDICTED: peroxisome biogenesis protein 12-like [Glycine max] Back     alignment and taxonomy information
>gi|356573139|ref|XP_003554721.1| PREDICTED: peroxisome biogenesis protein 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
TAIR|locus:2100890393 PEX12 "AT3G04460" [Arabidopsis 0.997 0.847 0.687 9.2e-123
DICTYBASE|DDB_G0285523459 pex12 "peroxin 12" [Dictyostel 0.595 0.433 0.349 4.2e-42
UNIPROTKB|J9NYE4359 PEX12 "Uncharacterized protein 0.613 0.571 0.298 4.4e-34
UNIPROTKB|A4FUD4359 PEX12 "Peroxisome assembly pro 0.616 0.573 0.285 7.1e-34
UNIPROTKB|F1S181359 PEX12 "Uncharacterized protein 0.616 0.573 0.280 3e-33
UNIPROTKB|O00623359 PEX12 "Peroxisome assembly pro 0.610 0.568 0.273 1e-32
RGD|620757359 Pex12 "peroxisomal biogenesis 0.598 0.557 0.293 4.3e-32
MGI|MGI:2144177359 Pex12 "peroxisomal biogenesis 0.613 0.571 0.284 1.1e-31
UNIPROTKB|Q9ET67359 PEX12 "Peroxisome assembly pro 0.592 0.551 0.295 3.8e-31
UNIPROTKB|E1BXZ1356 PEX12 "Uncharacterized protein 0.682 0.640 0.262 1.1e-29
TAIR|locus:2100890 PEX12 "AT3G04460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1207 (429.9 bits), Expect = 9.2e-123, P = 9.2e-123
 Identities = 229/333 (68%), Positives = 263/333 (78%)

Query:     1 MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVV 60
             MLILE HSLR TD SF+ESLYGLRR+S R+R +KD  R  SS+ + HSGLEKRQR+LSVV
Sbjct:    60 MLILEGHSLRTTDGSFAESLYGLRRKSARLRLRKDSARKDSSEEVQHSGLEKRQRILSVV 119

Query:    61 FMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETS 120
             F+VVLPYFKSKLH++YNKEREARL+ SLWG  D+ FD+ D+F G  + +      + E S
Sbjct:   120 FLVVLPYFKSKLHAIYNKEREARLRESLWGAEDQGFDEADFFTGDDSIVSREPSGNEELS 179

Query:   121 VRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQ 180
             VR  L  KI+K I  CYPW+HAS EGLSFTYQLLYLLDATGFYS+GL ALGI VCRATGQ
Sbjct:   180 VRVQLATKIKKFIAVCYPWIHASSEGLSFTYQLLYLLDATGFYSLGLQALGIQVCRATGQ 239

Query:   181 ELMDNXXXXXXXXXXXXXXLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEW 240
             ELMD               L GP WLK +QGALLSC+Y +LDYAQTGLIAAVF FKMMEW
Sbjct:   240 ELMDTSSRISKIRNHERERLRGPPWLKTVQGALLSCSYAVLDYAQTGLIAAVFIFKMMEW 299

Query:   241 WYQSAEERMSAPTVYXXXXXXXXXKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVF 300
             WYQSAEER+SAPTVY         K+A+EGIPLPPDR++C LC QKRANPSVVTVSGFVF
Sbjct:   300 WYQSAEERLSAPTVYPPPPPPPAPKMAKEGIPLPPDRSLCALCLQKRANPSVVTVSGFVF 359

Query:   301 CYACIFKYVSQYKRCPVTLMPATVEQIRRLFHD 333
             CY+C+FKYVS+YKRCPVTL+PA+V+QIRRLF D
Sbjct:   360 CYSCVFKYVSKYKRCPVTLIPASVDQIRRLFQD 392
GO:0005622 "intracellular" evidence=IEA
GO:0006625 "protein targeting to peroxisome" evidence=IEA
GO:0008022 "protein C-terminus binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005777 "peroxisome" evidence=IDA
GO:0007031 "peroxisome organization" evidence=IMP
GO:0048598 "embryonic morphogenesis" evidence=IMP
GO:0005778 "peroxisomal membrane" evidence=IDA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA;IDA;IMP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA;IMP
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
DICTYBASE|DDB_G0285523 pex12 "peroxin 12" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYE4 PEX12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUD4 PEX12 "Peroxisome assembly protein 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S181 PEX12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O00623 PEX12 "Peroxisome assembly protein 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620757 Pex12 "peroxisomal biogenesis factor 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2144177 Pex12 "peroxisomal biogenesis factor 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ET67 PEX12 "Peroxisome assembly protein 12" [Cricetulus longicaudatus (taxid:10030)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXZ1 PEX12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M841PEX12_ARATHNo assigned EC number0.74770.99700.8473yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
pfam04757215 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal 7e-27
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-08
smart0018440 smart00184, RING, Ring finger 9e-05
>gnl|CDD|218247 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal region Back     alignment and domain information 
 Score =  105 bits (263), Expect = 7e-27
 Identities = 62/242 (25%), Positives = 95/242 (39%), Gaps = 64/242 (26%)

Query: 1   MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVV 60
            L+ E  +L   +A+  E  YGL+R +     +                L ++QR+LS++
Sbjct: 37  KLLYERLTLLRGNATLGEEFYGLKRVNEDDEGRL---------------LSRKQRLLSLL 81

Query: 61  FMVVLPYFKSKLHSVYNKEREARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETS 120
            +V+ PY   KL S+  +  E  L+ SL                                
Sbjct: 82  LLVLGPYLLRKLDSLLERLLEEDLENSLL------------------------------- 110

Query: 121 VRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDATGFYSVGLHALGIHVCRATGQ 180
            R S   ++++ +   YP L+A  E L+  + LL+L   T +YS+    LGI   R    
Sbjct: 111 -RQSRLSRLKRRLLKLYPALNALLELLNLLHFLLFLFGGT-YYSLSKRLLGIRYVRLNQS 168

Query: 181 ELMDNSSRISKIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMMEW 240
           +L  N S             LG L L +L   LL      L      L A++FF K +EW
Sbjct: 169 DLERNVSY----------EFLGRLLLWQLFVELL------LFLLPLLLPASLFFLKFLEW 212

Query: 241 WY 242
           WY
Sbjct: 213 WY 214

This region is found at the N terminal of a number of known and predicted peroxins including Pex2, Pex10 and Pex12. This conserved region is usually associated with a C terminal ring finger (pfam00097) domain. Length = 215
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 334
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 100.0
PF04757229 Pex2_Pex12: Pex2 / Pex12 amino terminal region; In 99.97
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.47
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.4
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.31
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.27
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.24
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.2
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.14
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.98
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.92
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.9
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
PHA02929238 N1R/p28-like protein; Provisional 98.87
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.87
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.85
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.82
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.76
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.71
KOG3039303 consensus Uncharacterized conserved protein [Funct 98.66
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.66
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.59
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.56
PHA02926242 zinc finger-like protein; Provisional 98.51
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.45
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.42
PF1463444 zf-RING_5: zinc-RING finger domain 98.41
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.41
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.37
PF04641260 Rtf2: Rtf2 RING-finger 98.16
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.1
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.04
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.03
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.99
KOG2660 331 consensus Locus-specific chromosome binding protei 97.94
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.93
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.85
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.68
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.54
COG5222427 Uncharacterized conserved protein, contains RING Z 97.53
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.5
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
COG5152259 Uncharacterized conserved protein, contains RING a 97.21
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.03
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.97
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.93
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.82
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.8
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.73
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.36
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.3
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.26
KOG3039 303 consensus Uncharacterized conserved protein [Funct 96.14
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.13
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.09
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.04
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.78
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.64
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 95.35
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.11
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 94.86
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.86
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.78
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.68
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.66
KOG3113 293 consensus Uncharacterized conserved protein [Funct 94.28
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.27
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 94.24
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.81
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 93.53
KOG2979262 consensus Protein involved in DNA repair [General 93.39
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 93.21
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 93.03
KOG3002 299 consensus Zn finger protein [General function pred 92.91
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.76
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 92.7
KOG0298 1394 consensus DEAD box-containing helicase-like transc 92.46
COG52191525 Uncharacterized conserved protein, contains RING Z 91.87
COG5236 493 Uncharacterized conserved protein, contains RING Z 91.49
PRK04023 1121 DNA polymerase II large subunit; Validated 90.82
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 90.64
PLN02189 1040 cellulose synthase 89.19
KOG4367 699 consensus Predicted Zn-finger protein [Function un 89.05
KOG1941518 consensus Acetylcholine receptor-associated protei 88.62
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 88.58
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 88.31
PLN02436 1094 cellulose synthase A 87.91
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.34
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 86.7
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 86.54
PHA03096284 p28-like protein; Provisional 86.45
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 86.19
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 85.71
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 85.5
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 84.89
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.82
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.18
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 83.45
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 83.3
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 82.72
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.61
PRK05978148 hypothetical protein; Provisional 82.34
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.62
PLN02195 977 cellulose synthase A 81.36
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 80.94
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 80.5
KOG2068327 consensus MOT2 transcription factor [Transcription 80.28
COG1592166 Rubrerythrin [Energy production and conversion] 80.15
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.2e-73  Score=528.39  Aligned_cols=291  Identities=37%  Similarity=0.662  Sum_probs=248.3

Q ss_pred             CeeeeecccccCCCcccccccCeeeeccccccccccccccCCCCccCCCCCcchHHHHHHHHHHHHhHHHHHHHHHHHhH
Q 019860            1 MLILETHSLRNTDASFSESLYGLRRRSVRIRAKKDDTRLKSSDGIHHSGLEKRQRVLSVVFMVVLPYFKSKLHSVYNKER   80 (334)
Q Consensus         1 ~llvE~~~Lk~~~aSFaE~FYGLkR~~~~~~~~~~~~~~~~~~~~~~~~Lt~~q~~~sLl~lV~~PYlk~KLd~~ye~~~   80 (334)
                      |++||+|||++|||||+||||||||...++.-        .+.|+++.+|.++|+++|+++||++||+++|||++|++++
T Consensus        64 ~liLq~hyLr~~~sSF~E~fYgLqr~ss~drl--------~se~~~~~~l~krQr~~s~~~lv~lPYv~~KL~~i~~k~~  135 (357)
T KOG0826|consen   64 DLILQWHYLRTYNSSFIESFYGLQRISSRDRL--------TSEWPQGLGLNKRQRIVSFLFLVILPYVEAKLDEIYEKLR  135 (357)
T ss_pred             HHHHHHHHHhcccccHHHhhhhhhhhhccccc--------cccccCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            57999999999999999999999999877542        1457778899999999999999999999999999999965


Q ss_pred             HHHHhhhhcCCCCCCCCCccCCCCCCCCCccCCCCCCchhhhhhHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhCCC
Q 019860           81 EARLQASLWGPTDERFDDVDYFGGGGNPLFSRGGTDAETSVRTSLTKKIQKIIFACYPWLHASCEGLSFTYQLLYLLDAT  160 (334)
Q Consensus        81 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~f~~~YP~i~~~~e~~~l~~~l~YL~g~t  160 (334)
                      +.....+                                  .+.-+++.+++|..+||+|++++|+++++.++.|+.+++
T Consensus       136 e~~~~~S----------------------------------~e~~~~~~~~aF~~~~p~i~~a~els~lvq~l~yIlkrs  181 (357)
T KOG0826|consen  136 ENNEFSS----------------------------------DETENKRPKRAFLRIYPFIKMALELSKLVQQLRYILKRS  181 (357)
T ss_pred             hcccccC----------------------------------chhhhhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4321110                                  011257889999999999999999999999999999999


Q ss_pred             CCCCHHHHHhcceEeecccccccccchhhh--hhhhhhHhhhcChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 019860          161 GFYSVGLHALGIHVCRATGQELMDNSSRIS--KIRSRERERLLGPLWLKKLQGALLSCAYTMLDYAQTGLIAAVFFFKMM  238 (334)
Q Consensus       161 ~y~sP~l~l~gi~l~R~~~~d~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~iF~lKfL  238 (334)
                      ..||||+|++|+.++.++++|+.+.+....  ....+.....+..++...+++.++++...+.++++++|+++||+|||+
T Consensus       182 ~~hSPll~lsgv~L~~lt~~dl~a~~~gp~e~~~~~q~~r~t~~e~i~l~~qgaL~~~~~~v~~~~stgl~~~vFflqfl  261 (357)
T KOG0826|consen  182 SHHSPLLYLSGVQLGTLTPEDLQALEHGPAELSMMDQPARKTVSEKIFLLMQGALKKAVRGVAFSLSTGLSVGVFFLQFL  261 (357)
T ss_pred             ccccHHHHHhhcccccccHHHHHHhhccccccchhhhhhhhhhhhhHHHHHHhHHHHHHhhHHHHHHhhHHHHHHHHHHH
Confidence            999999999999999999999977433221  112223333334456677889999999999999999999999999999


Q ss_pred             HHHhcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCcccccCCcccccHHHHHHHhhcCCCCCCC
Q 019860          239 EWWYQSAEERMSAPTVYPPPPPPPPPKVAREGIPLPPDRTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVT  318 (334)
Q Consensus       239 EWWyss~~~r~~~~~~lp~pppP~~~~~~~~~~~~~~~~~~CpiC~~~~~~p~~~~~~G~vfC~~Ci~~~~~~~~~CPv~  318 (334)
                      ||||++|+++..+.+..|+|||||....+.++...|.|+..||+|++.++||+|+.++||||||+||++|+.++++||||
T Consensus       262 dWWyssd~~~~~k~~l~~p~PpPPh~~~~se~e~l~~~~~~CpvClk~r~Nptvl~vSGyVfCY~Ci~~Yv~~~~~CPVT  341 (357)
T KOG0826|consen  262 DWWYSSDNQRKIKSTLDPPIPPPPHKQYNSESELLPPDREVCPVCLKKRQNPTVLEVSGYVFCYPCIFSYVVNYGHCPVT  341 (357)
T ss_pred             HHHhcchHHHhhccCCCCCCCcCChhhcccccccCCCccccChhHHhccCCCceEEecceEEeHHHHHHHHHhcCCCCcc
Confidence            99999999887777776677777655556778888889999999999999999999999999999999999999999999


Q ss_pred             CCCCCccCeeeCccC
Q 019860          319 LMPATVEQIRRLFHD  333 (334)
Q Consensus       319 ~~~~~~~~l~ri~~~  333 (334)
                      +.|+.++||+|+|.+
T Consensus       342 ~~p~~v~~l~rl~~~  356 (357)
T KOG0826|consen  342 GYPASVDHLIRLFNK  356 (357)
T ss_pred             CCcchHHHHHHHhcC
Confidence            999999999999975

>PF04757 Pex2_Pex12: Pex2 / Pex12 amino terminal region; InterPro: IPR006845 This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-06
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-04
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 4e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 7e-04
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
 Score = 49.3 bits (118), Expect = 2e-08
 Identities = 11/52 (21%), Positives = 24/52 (46%)

Query: 279 ICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRL 330
           +C +  +    P +   S  +F  + + +YV      P+T  P ++E+I  +
Sbjct: 5   LCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEI 56
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.46
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.43
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.43
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.41
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.4
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.38
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.36
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.36
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.34
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.33
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.33
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.28
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.27
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.27
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.26
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.25
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.24
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.24
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.23
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.23
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.23
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.22
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.22
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.22
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.21
2ect_A78 Ring finger protein 126; metal binding protein, st 99.18
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.18
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.17
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.17
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.17
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.17
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.15
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.14
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.12
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.11
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.11
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.09
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.09
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.08
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.07
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.07
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.03
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.96
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.95
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.93
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.92
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.91
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.91
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.91
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.9
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.81
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.78
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.77
2ea5_A68 Cell growth regulator with ring finger domain prot 98.75
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.62
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.61
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.43
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.39
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.33
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.25
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.16
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 97.58
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.12
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.66
3nw0_A238 Non-structural maintenance of chromosomes element 96.58
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 94.18
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 92.84
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 92.14
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.34
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 90.78
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 90.23
3vth_A 761 Hydrogenase maturation factor; carbamoyltransfer, 88.26
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.24
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 86.37
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 86.34
4g9i_A 772 Hydrogenase maturation protein HYPF; zinc finger, 82.65
3ttc_A 657 HYPF, transcriptional regulatory protein; Zn finge 81.8
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 81.62
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 80.88
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 80.58
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
Probab=99.46  E-value=3.1e-14  Score=104.18  Aligned_cols=56  Identities=20%  Similarity=0.366  Sum_probs=51.5

Q ss_pred             CCCCCcCCCCCCCcccccCCcccccHHHHHHHhhcCCCCCCCCCCCCccCeeeCcc
Q 019860          277 RTICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFH  332 (334)
Q Consensus       277 ~~~CpiC~~~~~~p~~~~~~G~vfC~~Ci~~~~~~~~~CPv~~~~~~~~~l~ri~~  332 (334)
                      ...||||++.++||++++.|||+||..||.+|++++++||+|+.+++.+||+++..
T Consensus         3 ~~~CpIs~~~m~dPV~~~~sG~~yer~~I~~~l~~~~~cP~t~~~L~~~~Lip~~~   58 (61)
T 2bay_A            3 HMLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVP   58 (61)
T ss_dssp             -CCCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCC
T ss_pred             eEEecCCCCCCCCCEEeCCCCcEEcHHHHHHHHHhCCCCcCCcCCCChhhcEECcc
Confidence            46899999999999887349999999999999999999999999999999999875
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis} Back     alignment and structure
>3ttc_A HYPF, transcriptional regulatory protein; Zn finger, nucleotide binding, hydrogenase maturation factor transferase; HET: ADP; 1.86A {Escherichia coli} PDB: 3tsp_A* 3tsu_A* 3ttf_A* 3ttd_A 3tsq_A Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 334
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 1e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 0.001
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.002
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.004
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 40.1 bits (93), Expect = 1e-05
 Identities = 11/52 (21%), Positives = 24/52 (46%)

Query: 279 ICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRL 330
           +C +  +    P +   S  +F  + + +YV      P+T  P ++E+I  +
Sbjct: 2   LCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEI 53
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.67
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.41
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.35
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.35
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.31
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.3
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.23
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.18
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.17
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.16
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.01
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.94
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.81
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.75
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.44
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.91
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 94.5
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 91.7
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 91.22
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 90.85
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 88.84
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 88.64
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 85.73
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 84.79
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 83.92
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 82.93
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.67  E-value=1.3e-17  Score=118.40  Aligned_cols=54  Identities=20%  Similarity=0.380  Sum_probs=51.3

Q ss_pred             CCCcCCCCCCCcccccCCcccccHHHHHHHhhcCCCCCCCCCCCCccCeeeCcc
Q 019860          279 ICPLCSQKRANPSVVTVSGFVFCYACIFKYVSQYKRCPVTLMPATVEQIRRLFH  332 (334)
Q Consensus       279 ~CpiC~~~~~~p~~~~~~G~vfC~~Ci~~~~~~~~~CPv~~~~~~~~~l~ri~~  332 (334)
                      .||||++.++||++++.|||+||+.||.+|++++++||+|+.+++.+||++|..
T Consensus         2 ~C~Ic~~~~~~Pv~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipik~   55 (56)
T d2baya1           2 LCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVP   55 (56)
T ss_dssp             CCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCC
T ss_pred             CCccCCchHHhcCccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeCCC
Confidence            699999999999988779999999999999999999999999999999999864
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure