Citrus Sinensis ID: 019907

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----

MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLMAVIKNRKELYTAELKEFQRKRERILQQLASLQSERMVDKTSFEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSS

ccccccccccHHHHHHHHHcccccccEEEcccccHHHHHccccccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHcccccccccccccccccccccEEEEEEEEcccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccc

*SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNS******************DDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLMAVIKNRKELYTAELKEFQR***********************************GIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPL************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNSDAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCTGGQGDMDWLQMVQPVIQERIERYSKSEIRFNLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRMVDKTSFEALNKSLSEVNAGIEGATEKILMEEEKFKKWRTENIRRKHNYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin carboxyl-terminal hydrolase isozyme L5	Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome.	probable	Q54N38
Ubiquitin carboxyl-terminal hydrolase isozyme L5	Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.	probable	Q9XSJ0
Ubiquitin carboxyl-terminal hydrolase isozyme L5	Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.	probable	Q06AT3

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.19.-	Omega peptidases.	probable
3.4.19.12	Ubiquitinyl hydrolase 1.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHR, chain A
Confidence level:very confident
Coverage over the Query: 2-136,155-322
View the alignment between query and template
View the model in PyMOL