Citrus Sinensis ID: 019913

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPEI
ccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHcHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccEEEccccEEEccccccccccEEEccccEEEEccccccHHHHHcccccccccccccccccccccc
ccccEEEcccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHcccccEccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHcccccEEEEEEcccEEEcccEEEcccccEccccEEEEEEEEEccccccccccccccccccccccccccccc
mgkglipadldTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLegedsrggnsiELDLEAEFSSLALDIIGlgvfnydfgsvtkespvIKAVYGTLfeaehrstfyipywkiplarwivprQRKFQNDLKIINDCLDGLIRNAKETRQETDVeklqsrdysnlkdASLLRFLVDmrgadvddrQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDsvlgqkkptfesLKKLEYIRLIVAESlrlypqppllirrtikpdvlpggyrgdkdgypvpagtdIFLSVSSSYICLIYLFCSHCLPIWYAYQrirfepei
mgkglipadldtwkqRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRnaketrqetdveklqsrdysnlkdASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQaevdsvlgqkkptfeslkkLEYIRLIVAESlrlypqppllirrtikpdvlPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPEI
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPEI
******PADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLE********SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRN********************LKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQN********************TFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRF****
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEG****GGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIR*********************LKDASLLR*LV*******D**QLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPE*
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKE************RDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPS*********DSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPEI
*GKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGED*****SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHCLPIWYAYQRIRFEPEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query334 2.2.26 [Sep-21-2011]
O48921576 Cytochrome P450 97B2, chl yes no 0.907 0.526 0.871 1e-155
Q43078552 Cytochrome P450 97B1, chl N/A no 0.907 0.548 0.854 1e-153
O23365580 Cytochrome P450 97B3, chl yes no 0.907 0.522 0.819 1e-147
Q93VK5595 Protein LUTEIN DEFICIENT no no 0.850 0.477 0.509 6e-74
Q6TBX7539 Carotene epsilon-monooxyg no no 0.856 0.530 0.452 3e-66
O08336 1054 Probable bifunctional P-4 yes no 0.763 0.241 0.320 8e-31
P51869522 Cytochrome P450 4F4 OS=Ra yes no 0.889 0.568 0.271 2e-26
Q8N118509 Cytochrome P450 4X1 OS=Ho yes no 0.856 0.561 0.273 1e-25
P14779 1049 Bifunctional P-450/NADPH- yes no 0.736 0.234 0.276 1e-25
P33274524 Cytochrome P450 4F1 OS=Ra no no 0.916 0.583 0.273 1e-25
>sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 Back     alignment and function desciption
 Score =  547 bits (1410), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/303 (87%), Positives = 283/303 (93%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
           MGKGLIPADLDTWKQRRRVIAP FH  YLEAMV +F  CSERTI+KF KLLEGE   G +
Sbjct: 151 MGKGLIPADLDTWKQRRRVIAPAFHNSYLEAMVKIFTTCSERTILKFNKLLEGEGYDGPD 210

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
           SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI
Sbjct: 211 SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 270

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
           PLARWIVPRQRKFQ+DLK+IN CLDGLIRNAKE+RQETDVEKLQ RDY NLKDASLLRFL
Sbjct: 271 PLARWIVPRQRKFQDDLKVINTCLDGLIRNAKESRQETDVEKLQQRDYLNLKDASLLRFL 330

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
           VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSK+KKAQAEVD VLG  
Sbjct: 331 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKMKKAQAEVDLVLGTG 390

Query: 241 KPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIF 300
           +PTFESLK+L+YIRLIV E+LRLYPQPPLLIRR++K DVLPGG++G+KDGY +PAGTD+F
Sbjct: 391 RPTFESLKELQYIRLIVVEALRLYPQPPLLIRRSLKSDVLPGGHKGEKDGYAIPAGTDVF 450

Query: 301 LSV 303
           +SV
Sbjct: 451 ISV 453

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 Back     alignment and function description
>sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=1 SV=2 Back     alignment and function description
>sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 Back     alignment and function description
>sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 Back     alignment and function description
>sp|O08336|CYPE_BACSU Probable bifunctional P-450/NADPH-P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypE PE=2 SV=1 Back     alignment and function description
>sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 Back     alignment and function description
>sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 Back     alignment and function description
>sp|P14779|CPXB_BACME Bifunctional P-450/NADPH-P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 Back     alignment and function description
>sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
225464788 572 PREDICTED: cytochrome P450 97B2, chlorop 0.907 0.529 0.884 1e-156
255559122 555 cytochrome P450, putative [Ricinus commu 0.907 0.545 0.867 1e-154
351724791 576 cytochrome P450 97B2, chloroplastic [Gly 0.907 0.526 0.871 1e-153
224089583 579 cytochrome P450 [Populus trichocarpa] gi 0.907 0.523 0.854 1e-153
357481377 574 Cytochrome P450 [Medicago truncatula] gi 0.907 0.527 0.858 1e-152
5915854 552 RecName: Full=Cytochrome P450 97B1, chlo 0.907 0.548 0.854 1e-151
449514617 580 PREDICTED: cytochrome P450 97B2, chlorop 0.907 0.522 0.841 1e-149
449459994 580 PREDICTED: cytochrome P450 97B2, chlorop 0.907 0.522 0.841 1e-149
297800680 571 hypothetical protein ARALYDRAFT_493377 [ 0.907 0.530 0.825 1e-145
2244868 576 cytochrome P450 like protein [Arabidopsi 0.907 0.526 0.819 1e-145
>gi|225464788|ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera] gi|296087528|emb|CBI34117.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  558 bits (1439), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/303 (88%), Positives = 286/303 (94%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
           MGKGLIPADLDTWKQRRRVIAPGFHALYLEAM  +F +CSER I+KFEKLLEGE   GG 
Sbjct: 148 MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMTKVFTECSERAILKFEKLLEGEHLHGGK 207

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
           +IELDLEAEFS+LALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK+
Sbjct: 208 TIELDLEAEFSNLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKV 267

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
           PLARWIVPRQRKF +DLK+INDCLDGLI+NAKETRQETDVEKLQ RDY NLKDASLLRFL
Sbjct: 268 PLARWIVPRQRKFHSDLKVINDCLDGLIKNAKETRQETDVEKLQQRDYQNLKDASLLRFL 327

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
           VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSK+KKAQAE+DSVLGQ 
Sbjct: 328 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKMKKAQAEIDSVLGQG 387

Query: 241 KPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIF 300
           + +FESLKKLEYIRLIVAESLRLYPQPPLLIRR++K D LPGGY+G KDG+ +PAGTDIF
Sbjct: 388 RISFESLKKLEYIRLIVAESLRLYPQPPLLIRRSLKSDALPGGYKGKKDGHSIPAGTDIF 447

Query: 301 LSV 303
           LSV
Sbjct: 448 LSV 450

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255559122|ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis] gi|223540243|gb|EEF41816.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351724791|ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max] gi|5915855|sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor gi|2738996|gb|AAB94586.1| CYP97B2p [Glycine max] Back     alignment and taxonomy information
>gi|224089583|ref|XP_002308766.1| cytochrome P450 [Populus trichocarpa] gi|222854742|gb|EEE92289.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357481377|ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula] gi|355512309|gb|AES93932.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|5915854|sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome P450 97A2; Flags: Precursor gi|1360118|emb|CAA89260.1| cytochrome P450 [Pisum sativum] Back     alignment and taxonomy information
>gi|449514617|ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459994|ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297800680|ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. lyrata] gi|297314060|gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|2244868|emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana] gi|7268257|emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
TAIR|locus:2129695580 CYP97B3 ""cytochrome P450, fam 0.907 0.522 0.819 1.1e-133
TAIR|locus:2034476595 CYP97A3 ""cytochrome P450, fam 0.847 0.475 0.514 2.1e-70
TAIR|locus:2102023539 LUT1 "LUTEIN DEFICIENT 1" [Ara 0.856 0.530 0.455 1.8e-62
UNIPROTKB|A8CBR4520 CYP4F45 "Cytochrome P450 4F45" 0.916 0.588 0.273 5.2e-27
UNIPROTKB|Q8N118509 CYP4X1 "Cytochrome P450 4X1" [ 0.856 0.561 0.280 1.3e-26
RGD|708363522 Cyp4f4 "cytochrome P450, famil 0.919 0.588 0.276 1.9e-26
UNIPROTKB|P51869522 Cyp4f4 "Cytochrome P450 4F4" [ 0.919 0.588 0.276 1.9e-26
UNIPROTKB|Q66HK8524 Cyp4f1 "Cytochrome P450, famil 0.916 0.583 0.273 2.5e-26
UNIPROTKB|E1BYW5530 CYP4V2 "Uncharacterized protei 0.835 0.526 0.291 2.6e-26
RGD|70926524 Cyp4f1 "cytochrome P450, famil 0.916 0.583 0.273 3.2e-26
TAIR|locus:2129695 CYP97B3 ""cytochrome P450, family 97, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1310 (466.2 bits), Expect = 1.1e-133, P = 1.1e-133
 Identities = 249/304 (81%), Positives = 276/304 (90%)

Query:     1 MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLL-EGEDSRGG 59
             MGKGLIPADLDTWK RRR I P FH LYLEAMV +F+DCSE+ I+K EKL+ E E S G 
Sbjct:   156 MGKGLIPADLDTWKLRRRAITPAFHKLYLEAMVKVFSDCSEKMILKSEKLIREKETSSGE 215

Query:    60 NSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK 119
             ++IELDLEAEFSSLALDIIGL VFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFY PYW 
Sbjct:   216 DTIELDLEAEFSSLALDIIGLSVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYFPYWN 275

Query:   120 IPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRF 179
              P ARWIVPRQRKFQ+DLKIINDCLDGLI+NAKETRQETDVEKLQ RDY+NLKDASLLRF
Sbjct:   276 FPPARWIVPRQRKFQSDLKIINDCLDGLIQNAKETRQETDVEKLQERDYTNLKDASLLRF 335

Query:   180 LVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQ 239
             LVDMRG D+DDRQLRDDLMTMLIAGHETTAAVLTWAVFLL+QNP K++KAQAE+D+VLGQ
Sbjct:   336 LVDMRGVDIDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLSQNPEKIRKAQAEIDAVLGQ 395

Query:   240 KKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDI 299
               PT+ES+KKLEYIRLIV E LRL+PQPPLLIRRT+KP+ LPGG++G+K+G+ VP GTDI
Sbjct:   396 GPPTYESMKKLEYIRLIVVEVLRLFPQPPLLIRRTLKPETLPGGHKGEKEGHKVPKGTDI 455

Query:   300 FLSV 303
             F+SV
Sbjct:   456 FISV 459
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
TAIR|locus:2034476 CYP97A3 ""cytochrome P450, family 97, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102023 LUT1 "LUTEIN DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A8CBR4 CYP4F45 "Cytochrome P450 4F45" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N118 CYP4X1 "Cytochrome P450 4X1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|708363 Cyp4f4 "cytochrome P450, family 4, subfamily f, polypeptide 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P51869 Cyp4f4 "Cytochrome P450 4F4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66HK8 Cyp4f1 "Cytochrome P450, family 4, subfamily F, polypeptide 2, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|70926 Cyp4f1 "cytochrome P450, family 4, subfamily f, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O48921C97B2_SOYBN1, ., 1, 4, ., -, ., -0.87120.90710.5260yesno
O23365C97B3_ARATH1, ., 1, 4, ., -, ., -0.81900.90710.5224yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-104
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-102
pfam00067461 pfam00067, p450, Cytochrome P450 1e-39
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 4e-28
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 4e-23
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-22
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-20
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 6e-16
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-15
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-14
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 6e-14
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-12
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-12
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 6e-12
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-12
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-11
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-08
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-08
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 3e-07
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-07
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-07
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-06
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 5e-06
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 2e-04
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 7e-04
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information 
 Score =  319 bits (818), Expect = e-104
 Identities = 154/305 (50%), Positives = 201/305 (65%), Gaps = 22/305 (7%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKL-LEGEDSRGG 59
           MGKGLIPAD + W+ RRR I P  H  Y+ AM+++F   S+R   K +    +GED    
Sbjct: 210 MGKGLIPADGEIWRVRRRAIVPALHQKYVAAMISLFGQASDRLCQKLDAAASDGED---- 265

Query: 60  NSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWK 119
               +++E+ FS L LDIIG  VFNYDF S++ ++ +++AVY  L EAE RS   IP W+
Sbjct: 266 ----VEMESLFSRLTLDIIGKAVFNYDFDSLSNDTGIVEAVYTVLREAEDRSVSPIPVWE 321

Query: 120 IPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRD-YSNLKDASLLR 178
           IP+ + I PRQRK    LK+IND LD LI   K   +E   E+LQ  + Y N +D S+L 
Sbjct: 322 IPIWKDISPRQRKVAEALKLINDTLDDLIAICKRMVEE---EELQFHEEYMNERDPSILH 378

Query: 179 FLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLG 238
           FL+   G DV  +QLRDDLMTMLIAGHET+AAVLTW  +LL++ PS V K Q EVDSVLG
Sbjct: 379 FLL-ASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLG 437

Query: 239 QKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTD 298
            + PT E +KKL+Y   ++ ESLRLYPQPP+LIRR+++ D+L         GYP+  G D
Sbjct: 438 DRFPTIEDMKKLKYTTRVINESLRLYPQPPVLIRRSLENDML--------GGYPIKRGED 489

Query: 299 IFLSV 303
           IF+SV
Sbjct: 490 IFISV 494

Length = 633
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 334
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02738 633 carotene beta-ring hydroxylase 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.97
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-51  Score=382.27  Aligned_cols=296  Identities=25%  Similarity=0.440  Sum_probs=224.6

Q ss_pred             cccccCCCchHhhhhhcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccHHHHHHHHHHHHHHhhh
Q 019913            3 KGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGLGV   82 (334)
Q Consensus         3 ~gi~~~~g~~Wk~~Rk~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~~t~~vi~~~~   82 (334)
                      .+++.++|++||++|..++|.|+..+|+.|.|.+.+++.++++.+++....+       ..+++.+.+.+||.|||++++
T Consensus       116 ~~Lf~~~g~~WK~lR~~lsP~Fts~kmk~m~~t~~~~~~~l~~~l~~~~~~~-------~~~~~~dl~~~yT~DVI~~~A  188 (499)
T KOG0158|consen  116 LNLFFLRGERWKRLRTKLSPTFTSGKLKKMFPTMEEVGDELVRHLRRKSEGG-------QEGEIKDLCARYTTDVIGSCA  188 (499)
T ss_pred             cCchhccCchHHHHHHhhccccchhhHHHHHHHHHHHHHHHHHHHHHhhccc-------CCccHHHHHHHHHHHHHhHhh
Confidence            5788899999999999999999999999999999999999999998755422       256888899999999999999


Q ss_pred             ccCcCCCCCCCChHHHH-HHHHHHhhhhcccc-cccccccccchhccchhhhhhHhHHHHHHHHHHHHHHHHHhhhhhhH
Q 019913           83 FNYDFGSVTKESPVIKA-VYGTLFEAEHRSTF-YIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDV  160 (334)
Q Consensus        83 fg~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~  160 (334)
                      ||.+.+++......+.. -...+......... ......+|.+...+    +.........+++.+++..+.+.+...  
T Consensus       189 fG~~~~s~~d~~~~F~~~~~~~~~~~~~~~~l~~~~~~~~p~l~~~l----~~~~~~~~~~~~~~~~v~~~v~~R~~~--  262 (499)
T KOG0158|consen  189 FGLDANSLRDPKAEFRRMGRRAFFLSRGLFPLKFMLIFLFPKLALPL----RVKLFPEDVTDFFRKLVNSRVEQREKE--  262 (499)
T ss_pred             cccchhhhcCchHHHHHhhHHHHHHhhccchHhHhHHHHhHHHHHhh----hcccChHHHHHHHHHHHHHHHHHHHhc--
Confidence            99998876543332222 22222211110000 00011122211111    011122344455555555554433111  


Q ss_pred             HHhhhccccccchhhHHHHHHHhcCC---------CCChHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhChHHHHHHHH
Q 019913          161 EKLQSRDYSNLKDASLLRFLVDMRGA---------DVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQA  231 (334)
Q Consensus       161 ~~~~~~~~~~~~~~~ll~~l~~~~~~---------~l~~~~i~~~~~~~~~aG~dTt~~tl~~~~~~L~~~P~iq~klr~  231 (334)
                               +....|+++.+++.+..         .+|.+||+++++.|++||.||||+|+++++|.|++|||+|+|||+
T Consensus       263 ---------~~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLre  333 (499)
T KOG0158|consen  263 ---------NIERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLRE  333 (499)
T ss_pred             ---------CCCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHH
Confidence                     11234678877766532         599999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCC-CCHHHhhcChhHHHHHhhhhcCCCCCccccccccCCccccCCCCCCCCCcccCCCCeEEEccccchhhh
Q 019913          232 EVDSVLGQKK-PTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICL  310 (334)
Q Consensus       232 Ei~~v~~~~~-~~~~dl~~lpyL~avi~E~lRl~p~~~~~~r~~~~d~~~~~g~~~~~~g~~IPkGT~V~~~~~~~h~~~  310 (334)
                      ||+++..... ++++.+++|+||++||+||||+||++|...|+|++|..+++       ||.|||||.|.+++|++||||
T Consensus       334 EI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~-------~~~i~kG~~V~Ip~~alH~Dp  406 (499)
T KOG0158|consen  334 EIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPG-------GFVIPKGTPVMIPTYALHHDP  406 (499)
T ss_pred             HHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCC-------CeEeCCCCEEEeecccccCCc
Confidence            9999977644 99999999999999999999999999998899999998842       699999999999999999999


Q ss_pred             hhhhccCCCcccccccccccCCC
Q 019913          311 IYLFCSHCLPIWYAYQRIRFEPE  333 (334)
Q Consensus       311 ~~~~~~~~~~~~~~~~~~~~~~~  333 (334)
                      .||      |+..+++||||+|+
T Consensus       407 ~~~------p~Pe~F~PERF~~~  423 (499)
T KOG0158|consen  407 EYW------PEPEKFKPERFEEE  423 (499)
T ss_pred             ccC------CCcccCCCccCCCC
Confidence            998      55678899999986

>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-26
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-26
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-26
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-26
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-26
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-26
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-26
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-26
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-26
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-26
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-26
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-26
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 1e-26
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-26
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-26
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-26
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-26
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-26
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-26
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-26
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-26
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-26
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 3e-26
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 4e-26
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 4e-26
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-26
1fah_A471 Structure Of Cytochrome P450 Length = 471 5e-26
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 5e-26
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 5e-26
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 5e-26
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-26
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 6e-26
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 6e-26
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 6e-26
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 6e-26
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 9e-26
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-25
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 3e-25
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 3e-25
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 5e-25
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-24
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 3e-16
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-14
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-14
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-14
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 9e-14
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 9e-13
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-10
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-09
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-08
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-08
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-08
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-07
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 9e-07
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 9e-07
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 9e-07
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-06
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-06
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-06
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-06
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-06
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-06
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-06
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 3e-06
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 6e-06
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 8e-06
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 8e-06
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-05
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-05
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-05
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 7e-05
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 8e-05
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 9e-05
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 9e-05
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 9e-05
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-04
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 2e-04
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 2e-04
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 3e-04
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 6e-04
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 8e-04
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure 
Iteration: 1

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 146/289 (50%), Gaps = 43/289 (14%)
Query: 12  TWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFS 71
            WK+   ++ P F    ++    M  D + + + K+E+L   E         +++  + +
Sbjct: 96  NWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADE--------HIEVPEDMT 147
Query: 72  SLALDIIGLGVFNYDFGSVTKESP--VIKAVYGTLFEAEH---RSTFYIPYWKIPLARWI 126
            L LD IGL  FNY F S  ++ P   I ++   L EA +   R+    P +        
Sbjct: 148 RLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYD------- 200
Query: 127 VPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFLVDMR-- 184
              +R+FQ D+K++ND +D +I + K + +++D                LL  +++ +  
Sbjct: 201 -ENKRQFQEDIKVMNDLVDKIIADRKASGEQSD---------------DLLTHMLNGKDP 244
Query: 185 --GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQKKP 242
             G  +DD  +R  ++T LIAGHETT+ +L++A++ L +NP  ++KA  E   VL    P
Sbjct: 245 ETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVP 304
Query: 243 TFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGY---RGDK 288
           +++ +K+L+Y+ +++ E+LRL+P  P       +  VL G Y   +GD+
Sbjct: 305 SYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDE 353
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-92
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-74
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 8e-71
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-59
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-55
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-54
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-53
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-53
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-47
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-47
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-45
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-39
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-37
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 8e-29
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 5e-28
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 7e-28
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-27
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-23
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 7e-23
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 6e-16
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-15
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-15
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-14
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 5e-14
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 7e-14
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-14
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 9e-14
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-13
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-13
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-08
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 4e-08
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 4e-08
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 6e-08
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 9e-08
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-07
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-07
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-07
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-07
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 1e-07
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 3e-07
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-07
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-06
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 1e-06
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-06
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 2e-06
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-06
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-06
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-06
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 5e-06
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 5e-06
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 6e-06
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 6e-06
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 7e-06
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 8e-06
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 8e-06
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 9e-06
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 1e-05
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-05
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 1e-05
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 1e-05
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 1e-05
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 2e-05
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 2e-05
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-05
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-05
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 3e-05
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 4e-05
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 4e-05
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 5e-05
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 1e-04
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 1e-04
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 2e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score =  281 bits (720), Expect = 6e-92
 Identities = 81/311 (26%), Positives = 150/311 (48%), Gaps = 43/311 (13%)

Query: 1   MGKGLIPADLD--TWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRG 58
            G GL  +      WK+   ++ P F    ++    M  D + + + K+E+L   E    
Sbjct: 82  AGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADE---- 137

Query: 59  GNSIELDLEAEFSSLALDIIGLGVFNYDFGSVTKE--SPVIKAVYGTLFEAEHRSTFYIP 116
                +++  + + L LD IGL  FNY F S  ++   P I ++   L EA ++     P
Sbjct: 138 ----HIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANP 193

Query: 117 YWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASL 176
                        +R+FQ D+K++ND +D +I + K + +++D                L
Sbjct: 194 DDPAYD-----ENKRQFQEDIKVMNDLVDKIIADRKASGEQSD---------------DL 233

Query: 177 LRFLVDMR----GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAE 232
           L  +++ +    G  +DD  +R  ++T LIAGHETT+ +L++A++ L +NP  ++KA  E
Sbjct: 234 LTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEE 293

Query: 233 VDSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYP 292
              VL    P+++ +K+L+Y+ +++ E+LRL+P  P       +  VL G Y        
Sbjct: 294 AARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYP------- 346

Query: 293 VPAGTDIFLSV 303
           +  G ++ + +
Sbjct: 347 LEKGDELMVLI 357
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.96
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.85
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
Probab=100.00  E-value=3e-47  Score=359.18  Aligned_cols=295  Identities=26%  Similarity=0.423  Sum_probs=222.8

Q ss_pred             CcccccC-CCchHhhhhhcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccHHHHHHHHHHHHHHh
Q 019913            2 GKGLIPA-DLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIGL   80 (334)
Q Consensus         2 g~gi~~~-~g~~Wk~~Rk~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~~t~~vi~~   80 (334)
                      |.|++++ +|+.|+++||+++++|+.++++.+.+.+.+.++.+++.+.+....       ..++|+.+++..+++|+|+.
T Consensus        74 g~~~~~~~~g~~w~~~Rr~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~-------~~~vd~~~~~~~~~~dvi~~  146 (456)
T 3mdm_A           74 GQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADG-------QTPVSMQDMLTYTAMDILAK  146 (456)
T ss_dssp             TTSTTTCCCHHHHHHHHHHHGGGGSHHHHHTTHHHHHHHHHHHHHHHHHTCSS-------SSCEEHHHHHHHHHHHHHHH
T ss_pred             CCCcccCCChHHHHHHHhhcccccCHHHHHHHHHHHHHHHHHHHHHHHHhcCC-------CCeeeHHHHHHHHHHHHHHH
Confidence            5677775 899999999999999999999999999999999999988653221       23799999999999999999


Q ss_pred             hhccCcCCCCCCCC-hHHHHHHHHHHhhhhcccccccccccccchhccchhhhhhHhHHHHHHHHHHHHHHHHHhhhhhh
Q 019913           81 GVFNYDFGSVTKES-PVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETD  159 (334)
Q Consensus        81 ~~fg~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~  159 (334)
                      ++||.+++...... ++...+...+..... ...+...+ +|...   ...+.+.+..+.+.+.+...++++++..... 
T Consensus       147 ~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~-~p~~~---~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~-  220 (456)
T 3mdm_A          147 AAFGMETSMLLGAQKPLSQAVKLMLEGITA-SRNTLAKF-LPGKR---KQLREVRESIRFLRQVGRDWVQRRREALKRG-  220 (456)
T ss_dssp             HHHSCCCCGGGTCCHHHHHHHHHHHHHHHH-HHHSCGGG-CGGGH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT-
T ss_pred             HHcCCChhhhcccccHHHHHHHHHHHHHHH-HHHHHHHh-CchhH---HHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc-
Confidence            99999987654332 333333333222111 00011111 12110   0112233334445555555555544321100 


Q ss_pred             HHHhhhccccccchhhHHHHHHHhcCCCCChHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhChHHHHHHHHHHHHHhCC
Q 019913          160 VEKLQSRDYSNLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQ  239 (334)
Q Consensus       160 ~~~~~~~~~~~~~~~~ll~~l~~~~~~~l~~~~i~~~~~~~~~aG~dTt~~tl~~~~~~L~~~P~iq~klr~Ei~~v~~~  239 (334)
                                .....++++.+++..+..++++++.+++.++++||+|||+++++|++++|++||++|+|||+||+++++.
T Consensus       221 ----------~~~~~d~l~~ll~~~~~~~~~~~l~~~~~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~  290 (456)
T 3mdm_A          221 ----------EEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGS  290 (456)
T ss_dssp             ----------CCCCCCHHHHHHHHTSSCSSSHHHHHHHHHHHHHTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTT
T ss_pred             ----------ccchhhHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHcCC
Confidence                      0012358888776655568899999999999999999999999999999999999999999999999987


Q ss_pred             -CCCCHHHhhcChhHHHHHhhhhcCCCCCccccccccCCccccCCCCCCCCCcccCCCCeEEEccccchhhhhhhhccCC
Q 019913          240 -KKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYLFCSHC  318 (334)
Q Consensus       240 -~~~~~~dl~~lpyL~avi~E~lRl~p~~~~~~r~~~~d~~~~~g~~~~~~g~~IPkGT~V~~~~~~~h~~~~~~~~~~~  318 (334)
                       +.++++++++||||+|||+|+||++|++|...|++.+|+++        +||.|||||.|++++|++||||.+|     
T Consensus       291 ~~~~~~~~l~~lpyl~a~i~E~lRl~p~~~~~~r~~~~d~~i--------~g~~Ip~Gt~v~~~~~~~~~d~~~~-----  357 (456)
T 3mdm_A          291 KRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLI--------DGVRVPGNTPLLFSTYVMGRMDTYF-----  357 (456)
T ss_dssp             CSSCCHHHHHHCHHHHHHHHHHHHHCCSSCCEEEEECSCEEE--------TTEEECSSEEEEECHHHHHTCTTTS-----
T ss_pred             CCCCCHHHHhcCHHHHHHHHHHHHhCCCccccccccCCceeE--------CCEEECCCCEEEeehHHhcCCchhc-----
Confidence             57999999999999999999999999999888888888776        5899999999999999999999888     


Q ss_pred             CcccccccccccCCC
Q 019913          319 LPIWYAYQRIRFEPE  333 (334)
Q Consensus       319 ~~~~~~~~~~~~~~~  333 (334)
                       |+..+++|+||.++
T Consensus       358 -~dp~~F~PeRfl~~  371 (456)
T 3mdm_A          358 -EDPLTFNPDRFGPG  371 (456)
T ss_dssp             -SSTTSCCGGGGSTT
T ss_pred             -CCccccCccccCCC
Confidence             45567888998754
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 334
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-25
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-18
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-18
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 8e-10
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  102 bits (254), Expect = 6e-25
 Identities = 55/306 (17%), Positives = 107/306 (34%), Gaps = 21/306 (6%)

Query: 1   MGKGLIPADLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGN 60
            G G+I A+ + W+  RR          +          S    ++ E     E+ R   
Sbjct: 82  QGYGVIFANGERWRALRRFSLATMRDFGMGKR-------SVEERIQEEARCLVEELRKSK 134

Query: 61  SIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKI 120
              LD    F S+  +II   VF   F         +  ++   F      +  +     
Sbjct: 135 GALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFS 194

Query: 121 PLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQETDVEKLQSRDYSNLKDASLLRFL 180
              +      R+   +L+ IN  +   +   + T   ++                 +   
Sbjct: 195 GFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLL------RMEKD 248

Query: 181 VDMRGADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEVDSVLGQK 240
                ++   + L   ++++  AG ETT+  L +   L+ + P   ++ Q E++ V+G  
Sbjct: 249 KSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSH 308

Query: 241 K-PTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDI 299
           + P  +   K+ Y   ++ E  RL    P  +  T+  D    GY        +P  T++
Sbjct: 309 RPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYV-------IPKNTEV 361

Query: 300 FLSVSS 305
           F  +SS
Sbjct: 362 FPVLSS 367
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.95
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.94
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.92
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.92
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.92
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=100.00  E-value=4.2e-42  Score=321.36  Aligned_cols=290  Identities=28%  Similarity=0.517  Sum_probs=220.4

Q ss_pred             CcccccC--CCchHhhhhhcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccHHHHHHHHHHHHHH
Q 019913            2 GKGLIPA--DLDTWKQRRRVIAPGFHALYLEAMVNMFADCSERTIMKFEKLLEGEDSRGGNSIELDLEAEFSSLALDIIG   79 (334)
Q Consensus         2 g~gi~~~--~g~~Wk~~Rk~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~~~~~t~~vi~   79 (334)
                      |+|++++  +|++||++||++.++|+.++++.+.+.+.++++.+++.+.+. ..       +.++|+.+++..+++|+++
T Consensus        81 g~~~~~~~~~g~~wk~~Rk~l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~-~~-------~~~idl~~~~~~~~~~~i~  152 (453)
T d2ij2a1          81 GDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERL-NA-------DEHIEVPEDMTRLTLDTIG  152 (453)
T ss_dssp             TTSGGGSCTTSHHHHHHHHHHGGGGSTTTHHHHHHHHHHHHHHHHHHHHTC-CT-------TCCEEHHHHHHHHHHHHHH
T ss_pred             CCcEEecCCChHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHhhhc-CC-------CCccchHHHHHHHhhhcch
Confidence            6777764  799999999999999999999999999999999999988542 11       1378999999999999999


Q ss_pred             hhhccCcCCCCCCC--ChHHHHHHHHHHhhhhcccccccccccccchhccchhhhhhHhHHHHHHHHHHHHHHHHHhhhh
Q 019913           80 LGVFNYDFGSVTKE--SPVIKAVYGTLFEAEHRSTFYIPYWKIPLARWIVPRQRKFQNDLKIINDCLDGLIRNAKETRQE  157 (334)
Q Consensus        80 ~~~fg~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  157 (334)
                      .++||.+++....+  .+.+..+...+..........     .+....+....+.+.+..+.+.+++.+.++++..... 
T Consensus       153 ~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~-  226 (453)
T d2ij2a1         153 LCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRA-----NPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGE-  226 (453)
T ss_dssp             HHHHSCCCCGGGCSSCCHHHHHHHHHHHHHHHTC--------CTTSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-
T ss_pred             hcccccccchhhhccchHHHHhhhhccchhhhhhhhc-----ccccccchhhHHHHHHHHHHHHHHHHHHHhhhccccc-
Confidence            99999998754332  344444444333322111101     1111111112244445555666666665554432110 


Q ss_pred             hhHHHhhhccccccchhhHHHHHHHhc----CCCCChHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhChHHHHHHHHHH
Q 019913          158 TDVEKLQSRDYSNLKDASLLRFLVDMR----GADVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPSKVKKAQAEV  233 (334)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~ll~~l~~~~----~~~l~~~~i~~~~~~~~~aG~dTt~~tl~~~~~~L~~~P~iq~klr~Ei  233 (334)
                                    ...++++.+++..    +..+++.++.++++++++||+|||++++.|++++|+.||++|+++++|+
T Consensus       227 --------------~~~d~l~~ll~~~~~~~~~~ls~~ei~~~~~~~l~ag~~tta~~l~~~l~~L~~~p~~~~~~~~e~  292 (453)
T d2ij2a1         227 --------------QSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEA  292 (453)
T ss_dssp             --------------CCSSHHHHHHHCCCTTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             --------------cccchhhhhhhhcccccCcchhhhHHHhhhccccccccccchhhhhcchhhhhcccccchhhhhhh
Confidence                          1134666666432    2458999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCCCCHHHhhcChhHHHHHhhhhcCCCCCccccccccCCccccCCCCCCCCCcccCCCCeEEEccccchhhhhhh
Q 019913          234 DSVLGQKKPTFESLKKLEYIRLIVAESLRLYPQPPLLIRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSVSSSYICLIYL  313 (334)
Q Consensus       234 ~~v~~~~~~~~~dl~~lpyL~avi~E~lRl~p~~~~~~r~~~~d~~~~~g~~~~~~g~~IPkGT~V~~~~~~~h~~~~~~  313 (334)
                      +++.+...++++++++||||+|||+|+||++|+++...|++++++++.       +||.|||||.|+++.+++|+|+.+|
T Consensus       293 ~~~~~~~~~~~~~l~~~p~L~a~i~E~lR~~p~~~~~~r~~~~~~~~~-------~~~~ip~g~~v~~~~~~~~~d~~~~  365 (453)
T d2ij2a1         293 ARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLG-------GEYPLEKGDELMVLIPQLHRDKTIW  365 (453)
T ss_dssp             HHHCCSSSCCHHHHHTCHHHHHHHHHHHHHSCSSCEEEEEESSCEEET-------TTEEECTTCEEEEEHHHHTTCHHHH
T ss_pred             hhhhccccCChhhhhcCCcchhhhhhhhcccccccccccccccccccC-------CcceeecccccccchhhcccChhhc
Confidence            999998889999999999999999999999999999889888888764       4699999999999999999999988


Q ss_pred             hccCCCcccccccccccC
Q 019913          314 FCSHCLPIWYAYQRIRFE  331 (334)
Q Consensus       314 ~~~~~~~~~~~~~~~~~~  331 (334)
                      ..     +..+++|+||.
T Consensus       366 ~~-----dp~~F~PeRfl  378 (453)
T d2ij2a1         366 GD-----DVEEFRPERFE  378 (453)
T ss_dssp             CS-----CTTSCCGGGGS
T ss_pred             CC-----chhhcCccccC
Confidence            43     24456777775
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure