Citrus Sinensis ID: 019929

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MKTDMASTKSKGKRPIVEDNVGSQPRRKLTDVATSKPDGHARTNYLGEAERVKKMDNTKTVDVKVSVEKTQAMASKGKMLQTEKPLNKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKGSYASPPKSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccccccEEccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccEEEccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccEEccccc
cccccccccccccccEEEcccccccccHHHHHcccccccccccHHcccccccccccccccccccccHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccHHHcccccccccHHHHHHHHHHHEEEEHcccEEEEcccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccEEccccccccEEEEcccccccEEEEcccccEEEEcccccccccccHHHHHHHHcccccccHHHHHHHHHccccccccccccEEEEcccccEEEEEccc
mktdmastkskgkrpivednvgsqprrkltdvatskpdghartnYLGEAERvkkmdntktVDVKVSVEKTQAMASkgkmlqtekplnkhGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRistvpckgsyasppksgivygpFVCEICAEQktvhksfhikgcshayCTDCMVKYVAAKLEEnitaircpvvdcrgllepeycrdilpqdvFDRWGAALCEAVipgaqkfycpfkdcsamliddgeeviqesecpncrrlfcaqcqvpwhsgincvefqklnkdeREREDILLMKVAQKekwkrcpncryyvekkdgcmymkcrsvf
mktdmastkskgkrpivednvgsqprrkltdvatskpdghartnylgeaervkkmdntktvdvKVSVEKTqamaskgkmlqtekplnKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRIstvpckgsyasppkSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEEnitaircpvvDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKvaqkekwkrcpncryyvekkdgcmyMKCRSVF
MKTDMASTKSKGKRPIVEDNVGSQPRRKLTDVATSKPDGHARTNYLGEAERVKKMDNTKTVDVKVSVEKTQAMASKGKMLQTEKPLNKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKGSYASPPKSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
********************************************************************************************LAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKGSYASPPKSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKC****
******************************************************************************************DELAIVLEQLKSVENTMSFIDDRFGSLTESL*****************************VCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQK************LMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
***************IVEDNVGSQPRRKLTDVATSKPDGHARTNYLGEAERVKKMDNTKTVDVKVSVEKTQAMASKGKMLQTEKPLNKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKGSYASPPKSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
***************I**DNVGSQPRRKLTDVATSKPDGHARTNYLGEAERVKKMDNTKTVDVKVSVEKTQAMASKGKMLQTEKPLNKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKG************GPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTDMASTKSKGKRPIVEDNVGSQPRRKLTDVATSKPDGHARTNYLGEAERVKKMDNTKTVDVKVSVEKTQAMASKGKMLQTEKPLNKHGDELAIVLEQLKSVENTMSFIDDRFGSLTESLTELKQRISTVPCKGSYASPPKSGIVYGPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query334 2.2.26 [Sep-21-2011]
P50876292 Probable E3 ubiquitin-pro yes no 0.571 0.654 0.286 1e-13
D3YYI7515 Probable E3 ubiquitin-pro yes no 0.565 0.366 0.260 2e-13
Q925F3292 Probable E3 ubiquitin-pro no no 0.571 0.654 0.281 2e-12
P0CE101787 Putative uncharacterized no no 0.520 0.097 0.266 3e-12
E6ZIJ1707 RanBP-type and C3HC4-type N/A no 0.520 0.246 0.256 4e-12
Q8BKD6301 E3 ubiquitin-protein liga no no 0.559 0.621 0.266 4e-12
Q7Z419303 E3 ubiquitin-protein liga no no 0.565 0.623 0.261 5e-12
Q4KLT0282 Probable E3 ubiquitin-pro N/A no 0.517 0.613 0.237 5e-12
A4IIY1292 Probable E3 ubiquitin-pro no no 0.571 0.654 0.266 5e-12
A5PK27304 E3 ubiquitin-protein liga no no 0.565 0.621 0.266 9e-11
>sp|P50876|R144A_HUMAN Probable E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 91/199 (45%), Gaps = 8/199 (4%)

Query: 141 PKSGIVYGPFV-CEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENI-TAIRCPV 198
           P   +   P V C++C  +  V +   I  C   +CT C+ +YV   ++E + TAI CP 
Sbjct: 8   PTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPD 67

Query: 199 VDC--RGLLEPEYCRDILPQDVFDRWGAALCE-AVIPGAQKFYCPFKDCSAM--LIDDGE 253
             C  +G L+      ++  ++  R+     E  V+    + +CP   C A+  L D G 
Sbjct: 68  AACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGL 127

Query: 254 EVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCP 313
           +  Q  +C  CR  FC+ C+  WH G  C E   +     E      M+       KRCP
Sbjct: 128 QTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKME-EDDAPIKRCP 186

Query: 314 NCRYYVEKKDGCMYMKCRS 332
            C+ Y+E+ +GC  M C++
Sbjct: 187 KCKVYIERDEGCAQMMCKN 205
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 Back     alignment and function description
>sp|Q925F3|R144A_MOUSE Probable E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 Back     alignment and function description
>sp|P0CE10|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1 Back     alignment and function description
>sp|E6ZIJ1|HOIL1_DICLA RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Dicentrarchus labrax GN=rbck1 PE=3 SV=1 Back     alignment and function description
>sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 Back     alignment and function description
>sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 Back     alignment and function description
>sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 Back     alignment and function description
>sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 Back     alignment and function description
>sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
255550303400 zinc finger protein, putative [Ricinus c 0.553 0.462 0.724 8e-81
297738503329 unnamed protein product [Vitis vinifera] 0.796 0.808 0.517 1e-76
225444595358 PREDICTED: probable E3 ubiquitin-protein 0.796 0.743 0.517 2e-76
224142755307 predicted protein [Populus trichocarpa] 0.544 0.592 0.708 3e-75
356558463 685 PREDICTED: uncharacterized protein LOC10 0.691 0.337 0.535 2e-69
356530471333 PREDICTED: putative uncharacterized prot 0.544 0.546 0.655 2e-67
297820104322 zinc finger family protein [Arabidopsis 0.544 0.565 0.582 3e-62
356522436292 PREDICTED: probable E3 ubiquitin-protein 0.538 0.616 0.555 2e-61
255550305264 zinc finger protein, putative [Ricinus c 0.535 0.678 0.576 2e-60
356522438303 PREDICTED: probable E3 ubiquitin-protein 0.538 0.594 0.544 1e-59
>gi|255550303|ref|XP_002516202.1| zinc finger protein, putative [Ricinus communis] gi|223544688|gb|EEF46204.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  306 bits (784), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (85%)

Query: 150 FVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEY 209
           FVCEIC E KT  +S  I+GC+HAYCTDCM KYVA+K++ENIT I CPV  C GLLEPEY
Sbjct: 205 FVCEICVESKTADESLAIRGCTHAYCTDCMAKYVASKIQENITGIYCPVSGCGGLLEPEY 264

Query: 210 CRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFC 269
           CR ILPQ+VFDRWG ALCEA+  G+QKFYCPFKDCSAMLI+DG EVI+ESECP+CRRLFC
Sbjct: 265 CRSILPQEVFDRWGNALCEALNLGSQKFYCPFKDCSAMLINDGGEVIRESECPHCRRLFC 324

Query: 270 AQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYMK 329
           A C+VPWHSGI+C +FQ L+KDERE+EDI+LMK+A+ +KW+RCP CR YVE+ +GC YMK
Sbjct: 325 AHCKVPWHSGIDCNKFQTLHKDEREKEDIMLMKLAENKKWRRCPICRIYVERTEGCRYMK 384

Query: 330 CRSVF 334
           CR +F
Sbjct: 385 CRYIF 389

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142755|ref|XP_002324718.1| predicted protein [Populus trichocarpa] gi|222866152|gb|EEF03283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356558463|ref|XP_003547526.1| PREDICTED: uncharacterized protein LOC100803898 [Glycine max] Back     alignment and taxonomy information
>gi|356530471|ref|XP_003533804.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297820104|ref|XP_002877935.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323773|gb|EFH54194.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522436|ref|XP_003529852.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI3-like [Glycine max] Back     alignment and taxonomy information
>gi|255550305|ref|XP_002516203.1| zinc finger protein, putative [Ricinus communis] gi|223544689|gb|EEF46205.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356522438|ref|XP_003529853.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.544 0.568 0.562 1.1e-62
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.541 0.597 0.486 2.1e-54
TAIR|locus:2133935 532 AT4G19670 [Arabidopsis thalian 0.526 0.330 0.353 1.5e-30
TAIR|locus:2050100468 AT2G21420 [Arabidopsis thalian 0.550 0.393 0.329 3.6e-29
TAIR|locus:2151689444 AT5G37560 [Arabidopsis thalian 0.532 0.400 0.321 3.9e-28
TAIR|locus:2085622222 AT3G45470 [Arabidopsis thalian 0.532 0.801 0.333 1e-27
TAIR|locus:2085612348 AT3G45540 [Arabidopsis thalian 0.571 0.548 0.291 1.3e-27
TAIR|locus:2040065373 AT2G25360 [Arabidopsis thalian 0.535 0.479 0.306 7.3e-27
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.532 0.463 0.295 8.4e-26
TAIR|locus:504955785213 AT3G45555 [Arabidopsis thalian 0.550 0.863 0.277 1.4e-25
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 640 (230.4 bits), Expect = 1.1e-62, P = 1.1e-62
 Identities = 103/183 (56%), Positives = 142/183 (77%)

Query:   150 FVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEY 209
             F CEIC + K++ +SF I GCSH YC DC+ KY+AAKL++NI +I CPV  C G LEP+ 
Sbjct:   113 FDCEICVDSKSIIESFRIGGCSHFYCNDCVSKYIAAKLQDNILSIECPVSGCSGRLEPDQ 172

Query:   210 CRDILPQDVFDRWGAALCEAVIPGAQKFYCPFKDCSAML-IDDGEEVIQESECPNCRRLF 268
             CR ILP++VFDRWG ALCEAV+  ++KFYCP+KDCSA++ +++ E  +++SECP+C R+ 
Sbjct:   173 CRQILPKEVFDRWGDALCEAVVMRSKKFYCPYKDCSALVFLEESEVKMKDSECPHCHRMV 232

Query:   269 CAQCQVPWHSGINCVEFQKLNKDEREREDILLMKVAQKEKWKRCPNCRYYVEKKDGCMYM 328
             C +C   WH  + C EFQKL  +ER R+DILL  +A+++KWKRCP+C++Y+EK  GC+YM
Sbjct:   233 CVECGTQWHPEMTCEEFQKLAANERGRDDILLATMAKQKKWKRCPSCKFYIEKSQGCLYM 292

Query:   329 KCR 331
             KCR
Sbjct:   293 KCR 295
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050100 AT2G21420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151689 AT5G37560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955785 AT3G45555 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
smart0064764 smart00647, IBR, In Between Ring fingers 9e-11
pfam0148563 pfam01485, IBR, IBR domain 9e-06
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information 
 Score = 56.7 bits (137), Expect = 9e-11
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 220 DRWGAALCEAVIP-GAQKFYCPFKDCSAMLIDDGEEVIQESECPNCRRLFCAQCQVPWHS 278
           +++   L E+ +       +CP  DCSA +I   EE      CP C   FC +C+VPWHS
Sbjct: 1   EKYERLLLESYVESNPDLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPWHS 60

Query: 279 GINC 282
            ++C
Sbjct: 61  PVSC 64

the domains occurs between pairs og RING fingers. Length = 64
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 334
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 99.97
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.96
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.89
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.28
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.2
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.54
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.44
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.43
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.37
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.29
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.22
PF1463444 zf-RING_5: zinc-RING finger domain 98.2
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.08
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.88
PHA02926242 zinc finger-like protein; Provisional 97.76
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.67
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.65
PHA02929238 N1R/p28-like protein; Provisional 97.64
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.61
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.49
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.37
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.34
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.29
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.17
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.15
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.99
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.99
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.66
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.33
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.32
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.2
smart0064764 IBR In Between Ring fingers. the domains occurs be 96.07
KOG1002791 consensus Nucleotide excision repair protein RAD16 95.95
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.83
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.3
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.96
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.88
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.48
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.39
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 94.35
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 94.29
KOG2660 331 consensus Locus-specific chromosome binding protei 94.27
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 93.89
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 93.77
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.49
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.45
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 93.12
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 92.94
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.83
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 92.68
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.36
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.27
COG5152259 Uncharacterized conserved protein, contains RING a 92.16
KOG4739233 consensus Uncharacterized protein involved in syna 92.09
KOG4367 699 consensus Predicted Zn-finger protein [Function un 92.07
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 91.62
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 91.51
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 91.45
PF09788256 Tmemb_55A: Transmembrane protein 55A; InterPro: IP 90.91
smart0066152 RPOL9 RNA polymerase subunit 9. 90.66
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.49
PF1371937 zinc_ribbon_5: zinc-ribbon domain 90.48
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 90.46
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 90.05
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.8
PF04641260 Rtf2: Rtf2 RING-finger 89.53
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 89.36
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 88.99
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 88.87
PHA0062659 hypothetical protein 88.63
PRK0043250 30S ribosomal protein S27ae; Validated 88.37
KOG0825 1134 consensus PHD Zn-finger protein [General function 88.26
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 88.21
COG5175 480 MOT2 Transcriptional repressor [Transcription] 87.28
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.16
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.91
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 86.89
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.72
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 85.43
KOG3039303 consensus Uncharacterized conserved protein [Funct 85.15
KOG4445368 consensus Uncharacterized conserved protein, conta 84.97
smart0066152 RPOL9 RNA polymerase subunit 9. 84.69
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 84.68
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 84.5
COG5222427 Uncharacterized conserved protein, contains RING Z 84.44
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 83.59
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 83.46
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 83.45
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 83.1
PHA03096284 p28-like protein; Provisional 83.09
PRK14714 1337 DNA polymerase II large subunit; Provisional 82.76
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 82.72
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 82.34
PRK08665752 ribonucleotide-diphosphate reductase subunit alpha 81.35
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 81.2
KOG1001674 consensus Helicase-like transcription factor HLTF/ 80.86
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-34  Score=274.92  Aligned_cols=184  Identities=33%  Similarity=0.813  Sum_probs=156.1

Q ss_pred             ccccccccccccccC-CceeEecCCCCcccHHHHHHHHHhhhhCCeeeeecCCCcCCCCCchhhhhccCChHHHHHHHHH
Q 019929          147 YGPFVCEICAEQKTV-HKSFHIKGCSHAYCTDCMVKYVAAKLEENITAIRCPVVDCRGLLEPEYCRDILPQDVFDRWGAA  225 (334)
Q Consensus       147 ~~~~~C~IC~e~~~~-~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~i~CP~~~C~~~l~~~~i~~ll~~~~~~~y~~~  225 (334)
                      ....+|.||+.+.+. .+++....|+|.||.+||++|++++. .+...+.||..+|+..++.+.+..+|++++.++|++.
T Consensus       144 ~~~~~C~iC~~e~~~~~~~f~~~~C~H~fC~~C~k~~iev~~-~~~~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~  222 (384)
T KOG1812|consen  144 LPKEECGICFVEDPEAEDMFSVLKCGHRFCKDCVKQHIEVKL-LSGTVIRCPHDGCESRLTLESCRKLLTPKLREMWEQR  222 (384)
T ss_pred             cccccCccCccccccHhhhHHHhcccchhhhHHhHHHhhhhh-ccCCCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHH
Confidence            347899999955444 36666779999999999999999993 3446789999999999999999999999999999999


Q ss_pred             HHHhhcCCCCcccCCCCCCCceEEcCCc---cccccccCCccccccccccCccCCCCCCchhHHHHhhhhhhHHHHHHHH
Q 019929          226 LCEAVIPGAQKFYCPFKDCSAMLIDDGE---EVIQESECPNCRRLFCAQCQVPWHSGINCVEFQKLNKDEREREDILLMK  302 (334)
Q Consensus       226 ~~~~~~~~~~~~~CP~p~C~~~~~~~~~---~~~~~~~C~~C~~~fC~~C~~~~H~~~tC~~~~~~~~~~~~~~d~~~~~  302 (334)
                      +.+.++...+.+|||+|+|...+.....   .......|+.|+..||..|+.+||.+.+|++|++|..++.  .+..+.+
T Consensus       223 ~~e~~i~~~~~~ycp~~~C~~l~~~~el~~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~~~~--~d~~~~~  300 (384)
T KOG1812|consen  223 LKEEVIPSLDRVYCPYPRCSSLMSKTELSSEVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNPEEY--VDDITLK  300 (384)
T ss_pred             HHHHhhhhhhcccCCCCCchHhhhhhhhccchhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCCccc--ccHHHHH
Confidence            9999988877779999999987765431   3445578999999999999999999999999999976443  3334444


Q ss_pred             HHHhCCccccCCCCceeeeccCCCceEeecCC
Q 019929          303 VAQKEKWKRCPNCRYYVEKKDGCMYMKCRSVF  334 (334)
Q Consensus       303 ~~~~~~~k~CP~C~~~IeK~~GCnhMtC~Cg~  334 (334)
                      ++. ++|++||+|++.|++++|||||||+|||
T Consensus       301 ~la-~~wr~CpkC~~~ie~~~GCnhm~CrC~~  331 (384)
T KOG1812|consen  301 YLA-KRWRQCPKCKFMIELSEGCNHMTCRCGH  331 (384)
T ss_pred             HHH-HhcCcCcccceeeeecCCcceEEeeccc
Confidence            443 8999999999999999999999999996

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09788 Tmemb_55A: Transmembrane protein 55A; InterPro: IPR019178 Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction: 1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-14
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 8e-09
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 2e-06
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 66.8 bits (163), Expect = 3e-14
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 148 GPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEE-NITAIRCPVVDC--RGL 204
           G   C++C  +  V +   I  C   +CT C+ +YV   ++E   TAI CP   C  +G 
Sbjct: 4   GSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGH 63

Query: 205 LEPEYCRDILPQDVFDRWGAALCEAVIPGA 234
           L+      ++  ++  R+     E   P +
Sbjct: 64  LQENEIECMVAAEIMQRYKKLQFERSGPSS 93
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.7
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.33
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.08
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.08
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.86
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.79
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.72
2ect_A78 Ring finger protein 126; metal binding protein, st 98.61
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.59
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.58
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.57
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.57
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.57
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.56
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.56
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.55
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.54
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.54
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.53
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.53
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.52
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.49
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.49
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.49
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.46
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.46
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.45
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.45
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.44
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.43
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.42
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.41
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.4
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.39
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.38
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.36
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.35
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.33
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.31
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.27
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.24
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.19
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.17
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.16
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.11
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.1
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.09
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.01
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.93
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.92
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.73
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.65
2ea5_A68 Cell growth regulator with ring finger domain prot 97.44
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.44
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.4
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.26
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.22
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.21
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.19
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.96
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.84
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.42
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.09
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.74
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.45
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.9
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 94.79
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.91
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 92.25
3nw0_A238 Non-structural maintenance of chromosomes element 89.58
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 89.51
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 86.66
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 86.58
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 86.51
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 83.03
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 81.73
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 81.5
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 80.46
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 80.01
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.70  E-value=1.9e-17  Score=127.49  Aligned_cols=87  Identities=25%  Similarity=0.545  Sum_probs=77.7

Q ss_pred             cccccccccccccCCceeEecCCCCcccHHHHHHHHHhhhhCCe-eeeecCCCcCCCC--CchhhhhccCChHHHHHHHH
Q 019929          148 GPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEENI-TAIRCPVVDCRGL--LEPEYCRDILPQDVFDRWGA  224 (334)
Q Consensus       148 ~~~~C~IC~e~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~-~~i~CP~~~C~~~--l~~~~i~~ll~~~~~~~y~~  224 (334)
                      +.++|+||+++++..+++.+.+|||.||++||.+|+..+|.+|. .++.||..+|...  ++++.++.+++++++++|++
T Consensus         4 ~~~~C~IC~~~~~~~~~~~l~~CgH~FC~~Cl~~~~~~~i~~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky~~   83 (94)
T 1wim_A            4 GSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKK   83 (94)
T ss_dssp             SBCCCSSSCCCCBGGGEEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHHHH
T ss_pred             CCcCCcccCcccccccceEcCCCCCcccHHHHHHHHHHHhhcCCcccccCccccCCCCCccCHHHHHHHCCHHHHHHHHH
Confidence            46899999999987777777789999999999999999998774 6899998889999  99999999999999999999


Q ss_pred             HHHHhhcCCC
Q 019929          225 ALCEAVIPGA  234 (334)
Q Consensus       225 ~~~~~~~~~~  234 (334)
                      ++.+.++..+
T Consensus        84 ~~~~~~v~~~   93 (94)
T 1wim_A           84 LQFERSGPSS   93 (94)
T ss_dssp             HHHHSSCSSC
T ss_pred             HHHHhhhccC
Confidence            9888776543
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 334
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-09
d1wd2a_60 g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho 4e-05
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 4e-04
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 0.002
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.0 bits (124), Expect = 2e-09
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 148 GPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEE-NITAIRCPVVDCR--GL 204
           G   C++C  +  V +   I  C   +CT C+ +YV   ++E   TAI CP   C   G 
Sbjct: 4   GSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGH 63

Query: 205 LEPEYCRDILPQDVFDRW 222
           L+      ++  ++  R+
Sbjct: 64  LQENEIECMVAAEIMQRY 81
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.67
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.15
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.6
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.55
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.49
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.49
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.4
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.37
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.3
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.3
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.29
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.25
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.23
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.03
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 97.87
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.55
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.55
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.44
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 94.68
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 91.71
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 89.84
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 89.03
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 88.19
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.22
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 83.84
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 81.23
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 80.69
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.67  E-value=4e-17  Score=123.82  Aligned_cols=85  Identities=26%  Similarity=0.530  Sum_probs=74.8

Q ss_pred             cccccccccccccCCceeEecCCCCcccHHHHHHHHHhhhhCC-eeeeecCCCcCCC--CCchhhhhccCChHHHHHHHH
Q 019929          148 GPFVCEICAEQKTVHKSFHIKGCSHAYCTDCMVKYVAAKLEEN-ITAIRCPVVDCRG--LLEPEYCRDILPQDVFDRWGA  224 (334)
Q Consensus       148 ~~~~C~IC~e~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~-~~~i~CP~~~C~~--~l~~~~i~~ll~~~~~~~y~~  224 (334)
                      ...+|+||+++++..+++.++.|+|.||.+||..|++.+|.++ ...|+||...|+.  .+++.+|+.+++++++++|++
T Consensus         4 ~~~~C~IC~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky~~   83 (94)
T d1wima_           4 GSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKK   83 (94)
T ss_dssp             SBCCCSSSCCCCBGGGEEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHHHH
T ss_pred             CCCcCccCCCcccCCceEEECCCCCEeCCcCHHHHHHHHHhcCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHHHHH
Confidence            4678999999998888888889999999999999999999875 4789999988865  578889999999999999999


Q ss_pred             HHHHhhcC
Q 019929          225 ALCEAVIP  232 (334)
Q Consensus       225 ~~~~~~~~  232 (334)
                      +..+....
T Consensus        84 ~~l~~~~~   91 (94)
T d1wima_          84 LQFERSGP   91 (94)
T ss_dssp             HHHHSSCS
T ss_pred             HHHHhccc
Confidence            98876544
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure