Citrus Sinensis ID: 019963


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDGFLEGKYLSSSELLSPRAAPNLGLKSGSIQENLGPQTAKGKEMANQKAVQERPHVNNETITNHNGSASNSSSAPAAKAQVVGWPPIRSFRKNSLATSSKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWE
cccccccccccccccccEEECcccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccEEEEECcccCEEEEEcccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccCEEEEEcccccEEEccccccc
***********************************************************************TELRLG***********************************************************************************************************************************************************************ALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGS**A**REMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPW*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDGFLEGKYLSSSELLSPRAAPNLGLKSGSIQENLGPQTAKGKEMANQKAVQERPHVNNETITNHNGSASNSSSAPAAKAQVVGWPPIRSFRKNSLATSSKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin-responsive protein IAA8 Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.probableQ38826

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KKC, chain A
Confidence level:probable
Coverage over the Query: 245-282,308-328
View the alignment between query and template
View the model in PyMOL