Citrus Sinensis ID: 019982

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---

MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRSSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH

cccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccc

**************PEEVLQVLPSDPFEQLDVARKITSIAI*********************************************************************DVSKLEVF********************************************************************************************************************************************************EFFRQVRNRLSYEQFAIFLANVKELNAH*QT***TLRKTDEVFGPENKDLYTIFEGLIT****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxIESIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRSSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Uncharacterized protein At4g15545		probable	Q93W28

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 25-104
View the alignment between query and template
View the model in PyMOL

Template: 2LD7, chain B
Confidence level:probable
Coverage over the Query: 265-330
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 87-129
View the alignment between query and template
View the model in PyMOL