Citrus Sinensis ID: 019982

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRSSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH
ccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccc
cccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHccc
mlakepgagstfdlpeevlqvlpsdpfeqLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLkddedastgatriakptpnddaavaptgtssvhsqiseggnssfaeerepessrpgisrgfvlasqtstprltppgsppslsasvsptktpkpvsprrhsisfstsrgmfddrssilssvhsshssisssesgsqtgktrvdgKEFFRQVRNRLSYEQFAIFLANVKELnahkqtkeetlrktdevfgpenkdLYTIFEGLITRNVH
mlakepgagstfdlpeEVLQVLPSDPFEQLDVARKITSIAIstrvsdlesEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLskenealtntvrklqrdvsklevFRKTLvqslkddedastgatriakptpnddAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPpgsppslsasvsptktpkpvsprrhsisfstsrgmfddRSSILSSVHsshssisssesgsqtgktrvdGKEFFRQVRNRLSYEQFAIFLANVKelnahkqtkeetlrktdevfgpenkdlytifeglitrnvh
MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRssilssvhsshssisssesgsQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH
****************************QLDVARKITSIAI***************************************************************************VF********************************************************************************************************************************************************EFFRQVRNRLSYEQFAIFLANVKELN***************VFGPENKDLYTIFEGLIT****
**************PEEVLQVLPSDPFEQLDVARKITSIAI*********************************************************************DVSKLE*************************************************************************************************************************************************************RQVRNRLSYEQFAIFLANVKELNAH*QT***TLRKTDEVFGPENKDLYTIFEGLIT****
*********STFDLPEEVLQVLPSDPFEQLDVARKITSIAIST**********************IAELQSQIESIYSSLSD*************KENEALTNTVRKLQRDVSKLEVFRKTLVQS**********ATRIAKPTPND************************************ISRGFVLASQT*********************************ISFSTSRGMFDDRSS*************************VDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH
**********TFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSL*************************************************************************PPG****************************************************************VDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxIESIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRSSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query333 2.2.26 [Sep-21-2011]
Q93W28337 Uncharacterized protein A yes no 0.936 0.925 0.628 1e-107
>sp|Q93W28|Y4554_ARATH Uncharacterized protein At4g15545 OS=Arabidopsis thaliana GN=At4g15545 PE=1 SV=1 Back     alignment and function desciption
 Score =  387 bits (993), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/328 (62%), Positives = 248/328 (75%), Gaps = 16/328 (4%)

Query: 11  TFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIAELQ 70
           +FDLP+E+LQVLPSDPFEQLDVARKITSIA+STRVS LESE S LR  LAEK+    ELQ
Sbjct: 21  SFDLPDELLQVLPSDPFEQLDVARKITSIALSTRVSALESESSDLRELLAEKEKEFEELQ 80

Query: 71  SQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLK 127
           S +ES+ +SLSD   KL  A  +KE L +EN +L+NTV++LQRDVSKLE FRKTL+ SL+
Sbjct: 81  SHVESLEASLSDAFHKLSLADGEKENLIRENASLSNTVKRLQRDVSKLEGFRKTLMMSLQ 140

Query: 128 DDEDASTGATRI-AKPTPNDD-AAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPGISR 185
           DD D + G T+I AKPTPNDD     P+  SS+ SQ +       A + E ++ +P +S 
Sbjct: 141 DD-DQNAGTTQIIAKPTPNDDDTPFQPSRHSSIQSQQASEAIEPAATDNENDAPKPSLSA 199

Query: 186 GFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRSSILSS 245
              L SQT+TPRLTPPGSPP LSAS +P  T +P+SPRRHS+SF+T+RGMFDD       
Sbjct: 200 SLPLVSQTTTPRLTPPGSPPILSASGTPKTTSRPISPRRHSVSFATTRGMFDD------- 252

Query: 246 VHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTKEET 305
              + SSIS SE GSQT +TRVDGKEFFRQVR+RLSYEQF  FL NVK+LNAHKQT+EET
Sbjct: 253 ---TRSSISISEPGSQTARTRVDGKEFFRQVRSRLSYEQFGAFLGNVKDLNAHKQTREET 309

Query: 306 LRKTDEVFGPENKDLYTIFEGLITRNVH 333
           LRK +E+FG +N+DLY IFEGLITRN H
Sbjct: 310 LRKAEEIFGGDNRDLYVIFEGLITRNAH 337

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
255551573338 conserved hypothetical protein [Ricinus 0.993 0.979 0.758 1e-127
224107297346 predicted protein [Populus trichocarpa] 0.987 0.950 0.682 1e-113
449454446346 PREDICTED: uncharacterized protein LOC10 0.987 0.950 0.642 1e-111
359477457332 PREDICTED: uncharacterized protein LOC10 0.948 0.951 0.656 1e-109
356555589332 PREDICTED: uncharacterized protein LOC10 0.945 0.948 0.622 1e-108
357478533344 hypothetical protein MTR_4g118510 [Medic 0.975 0.944 0.635 1e-108
297804694335 hypothetical protein ARALYDRAFT_915246 [ 0.933 0.928 0.640 1e-106
18414476337 uncharacterized protein [Arabidopsis tha 0.936 0.925 0.628 1e-105
357478535338 hypothetical protein MTR_4g118510 [Medic 0.957 0.943 0.623 1e-104
357478537389 hypothetical protein MTR_4g118510 [Medic 0.975 0.835 0.561 1e-102
>gi|255551573|ref|XP_002516832.1| conserved hypothetical protein [Ricinus communis] gi|223543920|gb|EEF45446.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  462 bits (1189), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 258/340 (75%), Positives = 291/340 (85%), Gaps = 9/340 (2%)

Query: 1   MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLA 60
           MLAKE G GSTFDLPEEVLQVLPSDPFEQLDVARKITSIA+STRVS LESE SALR QLA
Sbjct: 1   MLAKESG-GSTFDLPEEVLQVLPSDPFEQLDVARKITSIALSTRVSSLESEFSALRLQLA 59

Query: 61  EKDSRIAELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEV 117
           EKD  IAELQS IES+ +SLSD   KL QA A+KE L KEN +L+N V+KLQRDVSKLEV
Sbjct: 60  EKDHLIAELQSHIESLDASLSDSADKLAQADAEKENLLKENASLSNIVKKLQRDVSKLEV 119

Query: 118 FRKTLVQSLKDDEDASTGATRI-AKPTPN-DDAAVAPTGTSSVHSQISEGGNSSFAEERE 175
           FRKTL++SL+DDE++S+GA  I AKPTP  DDA++ P+ TSS+ SQ SE GNS FAE+RE
Sbjct: 120 FRKTLMKSLQDDEESSSGAIPIIAKPTPTEDDASMLPSRTSSMRSQFSEMGNS-FAEDRE 178

Query: 176 PE-SSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRG 234
            + SSRPG+S G +LASQTSTPR TPPGSPPS SASVSPT+T KPVSPRRHS+SFSTSRG
Sbjct: 179 IDASSRPGMSHGPLLASQTSTPRFTPPGSPPSFSASVSPTRTSKPVSPRRHSMSFSTSRG 238

Query: 235 MFDDRSSILSSVHSSHSSISSS-ESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVK 293
           M DDRSS+ SS+ SS  S  SS E+GS TG+TRVDGKEFFRQVR+RLSYEQF  FLANVK
Sbjct: 239 MPDDRSSLFSSIPSSQHSSISSSETGSHTGRTRVDGKEFFRQVRSRLSYEQFGAFLANVK 298

Query: 294 ELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH 333
           ELN+HKQTKE+TLRK +E+FGP+NKDLY IFEGLITRNVH
Sbjct: 299 ELNSHKQTKEDTLRKAEEIFGPDNKDLYVIFEGLITRNVH 338

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224107297|ref|XP_002314437.1| predicted protein [Populus trichocarpa] gi|222863477|gb|EEF00608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454446|ref|XP_004144966.1| PREDICTED: uncharacterized protein LOC101217996 [Cucumis sativus] gi|449515179|ref|XP_004164627.1| PREDICTED: uncharacterized protein LOC101231402 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359477457|ref|XP_002278619.2| PREDICTED: uncharacterized protein LOC100252741 [Vitis vinifera] gi|297736943|emb|CBI26144.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555589|ref|XP_003546113.1| PREDICTED: uncharacterized protein LOC100776071 [Glycine max] Back     alignment and taxonomy information
>gi|357478533|ref|XP_003609552.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510607|gb|AES91749.1| hypothetical protein MTR_4g118510 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297804694|ref|XP_002870231.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] gi|297316067|gb|EFH46490.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18414476|ref|NP_567470.1| uncharacterized protein [Arabidopsis thaliana] gi|14517356|gb|AAK62569.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|15982813|gb|AAL09754.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|16323276|gb|AAL15372.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|21592639|gb|AAM64588.1| unknown [Arabidopsis thaliana] gi|22531186|gb|AAM97097.1| expressed protein [Arabidopsis thaliana] gi|23198008|gb|AAN15531.1| expressed protein [Arabidopsis thaliana] gi|332658223|gb|AEE83623.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357478535|ref|XP_003609553.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510608|gb|AES91750.1| hypothetical protein MTR_4g118510 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357478537|ref|XP_003609554.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510609|gb|AES91751.1| hypothetical protein MTR_4g118510 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
TAIR|locus:505006472337 AT4G15545 "AT4G15545" [Arabido 0.942 0.931 0.604 8.7e-95
TAIR|locus:2017933325 AT1G16520 "AT1G16520" [Arabido 0.936 0.96 0.423 2.1e-54
TAIR|locus:2205230310 AT1G56080 "AT1G56080" [Arabido 0.606 0.651 0.369 1.3e-29
MGI|MGI:96687487 Krt12 "keratin 12" [Mus muscul 0.453 0.310 0.267 9.3e-06
RGD|1304805456 Krt12 "keratin 12" [Rattus nor 0.450 0.328 0.259 6.6e-05
UNIPROTKB|Q6IFW5456 Krt12 "Keratin, type I cytoske 0.450 0.328 0.259 6.6e-05
DICTYBASE|DDB_G02920681096 frpA "fimbrin-related protein" 0.297 0.090 0.333 0.00013
UNIPROTKB|E7EMV0863 DIAPH1 "Protein diaphanous hom 0.573 0.221 0.248 0.00021
UNIPROTKB|F1PYV0509 KRT12 "Uncharacterized protein 0.453 0.296 0.248 0.00028
MGI|MGI:1914738691 Calcoco1 "calcium binding and 0.516 0.248 0.263 0.00033
TAIR|locus:505006472 AT4G15545 "AT4G15545" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 943 (337.0 bits), Expect = 8.7e-95, P = 8.7e-95
 Identities = 200/331 (60%), Positives = 241/331 (72%)

Query:     9 GS-TFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIA 67
             GS +FDLP+E+LQVLPSDPFEQLDVARKITSIA+STRVS LESE S LR  LAEK+    
Sbjct:    18 GSRSFDLPDELLQVLPSDPFEQLDVARKITSIALSTRVSALESESSDLRELLAEKEKEFE 77

Query:    68 ELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQ 124
             ELQS +ES+ +SLSD   KL  A  +KE L +EN +L+NTV++LQRDVSKLE FRKTL+ 
Sbjct:    78 ELQSHVESLEASLSDAFHKLSLADGEKENLIRENASLSNTVKRLQRDVSKLEGFRKTLMM 137

Query:   125 SLKDDEDASTGATRI-AKPTPNDD-AAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPG 182
             SL+DD D + G T+I AKPTPNDD     P+  SS+ SQ +       A + E ++ +P 
Sbjct:   138 SLQDD-DQNAGTTQIIAKPTPNDDDTPFQPSRHSSIQSQQASEAIEPAATDNENDAPKPS 196

Query:   183 ISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRXXX 242
             +S    L SQT+TPRLTPPGSPP LSAS +P  T +P+SPRRHS+SF+T+RGMFDD    
Sbjct:   197 LSASLPLVSQTTTPRLTPPGSPPILSASGTPKTTSRPISPRRHSVSFATTRGMFDD---- 252

Query:   243 XXXXXXXXXXXXXXXXXXQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTK 302
                               QT +TRVDGKEFFRQVR+RLSYEQF  FL NVK+LNAHKQT+
Sbjct:   253 ------TRSSISISEPGSQTARTRVDGKEFFRQVRSRLSYEQFGAFLGNVKDLNAHKQTR 306

Query:   303 EETLRKTDEVFGPENKDLYTIFEGLITRNVH 333
             EETLRK +E+FG +N+DLY IFEGLITRN H
Sbjct:   307 EETLRKAEEIFGGDNRDLYVIFEGLITRNAH 337
GO:0006833 "water transport" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0010075 "regulation of meristem growth" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2017933 AT1G16520 "AT1G16520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205230 AT1G56080 "AT1G56080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:96687 Krt12 "keratin 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304805 Krt12 "keratin 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IFW5 Krt12 "Keratin, type I cytoskeletal 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292068 frpA "fimbrin-related protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E7EMV0 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYV0 KRT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1914738 Calcoco1 "calcium binding and coiled coil domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93W28Y4554_ARATHNo assigned EC number0.62800.93690.9258yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_X4241
hypothetical protein (346 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 1e-04
pfam03962188 pfam03962, Mnd1, Mnd1 family 2e-04
pfam04156186 pfam04156, IncA, IncA protein 6e-04
pfam1232974 pfam12329, TMF_DNA_bd, TATA element modulatory fac 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 43.9 bits (104), Expect = 1e-04
 Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 4/109 (3%)

Query: 27  FEQLDVARKITSIA-ISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESI---YSSLSD 82
             +    R    I  +   + +LE +   L  +L E +  + EL+ ++E +      L D
Sbjct: 818 SLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELED 877

Query: 83  KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDED 131
           +L + + +KE L +E   L + + +L+ ++ KL    + L   L+  E 
Sbjct: 878 ELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEV 926

Length = 1163
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 333
PF0267147 PAH: Paired amphipathic helix repeat; InterPro: IP 96.91
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 96.78
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 96.08
PRK10884206 SH3 domain-containing protein; Provisional 96.0
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.9
PRK11637428 AmiB activator; Provisional 95.84
COG2433652 Uncharacterized conserved protein [Function unknow 95.46
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 95.17
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 95.06
PRK11637428 AmiB activator; Provisional 94.96
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.73
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.49
PF10186302 Atg14: UV radiation resistance protein and autopha 94.43
PRK09039343 hypothetical protein; Validated 94.32
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.55
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 93.53
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.39
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.36
PRK03918 880 chromosome segregation protein; Provisional 93.36
PRK10884206 SH3 domain-containing protein; Provisional 92.87
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 92.71
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.58
PRK02224 880 chromosome segregation protein; Provisional 92.35
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 92.17
KOG0288 459 consensus WD40 repeat protein TipD [General functi 92.14
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 92.11
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 91.94
COG5602 1163 SIN3 Histone deacetylase complex, SIN3 component [ 91.94
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 91.91
PHA02562562 46 endonuclease subunit; Provisional 91.47
KOG3990305 consensus Uncharacterized conserved protein [Funct 91.47
PHA02562562 46 endonuclease subunit; Provisional 91.46
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 91.29
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.28
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 91.15
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 91.13
KOG3433203 consensus Protein involved in meiotic recombinatio 91.11
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 90.76
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 90.64
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 90.55
PF13870177 DUF4201: Domain of unknown function (DUF4201) 90.52
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 90.5
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 90.42
PF13851201 GAS: Growth-arrest specific micro-tubule binding 89.88
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.79
KOG1103561 consensus Predicted coiled-coil protein [Function 89.77
COG4942420 Membrane-bound metallopeptidase [Cell division and 89.76
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 89.7
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.65
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 89.5
KOG4010208 consensus Coiled-coil protein TPD52 [General funct 89.39
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 89.26
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 89.16
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 88.97
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 88.86
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 88.71
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 88.58
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.38
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 88.38
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.33
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 88.24
PF10186302 Atg14: UV radiation resistance protein and autopha 88.05
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 88.02
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.82
PF11068131 YlqD: YlqD protein; InterPro: IPR021297 This bacte 87.82
PRK02224880 chromosome segregation protein; Provisional 87.8
KOG2685421 consensus Cystoskeletal protein Tektin [Cytoskelet 87.76
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 87.47
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 87.33
KOG4398359 consensus Predicted coiled-coil protein [General f 87.29
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 87.23
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 87.05
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 87.04
COG4942 420 Membrane-bound metallopeptidase [Cell division and 86.79
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 86.71
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 86.53
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 86.49
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 86.47
COG4026290 Uncharacterized protein containing TOPRIM domain, 86.44
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.37
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 86.29
PF13870177 DUF4201: Domain of unknown function (DUF4201) 86.23
PF13851201 GAS: Growth-arrest specific micro-tubule binding 86.2
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 86.12
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 86.06
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 86.05
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 86.05
KOG4204 231 consensus Histone deacetylase complex, SIN3 compon 85.85
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 85.83
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 85.78
PF00038312 Filament: Intermediate filament protein; InterPro: 85.69
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 85.66
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 85.36
KOG01611930 consensus Myosin class II heavy chain [Cytoskeleto 85.27
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 85.19
PF13863126 DUF4200: Domain of unknown function (DUF4200) 85.11
PF04201162 TPD52: Tumour protein D52 family; InterPro: IPR007 85.01
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.88
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 84.71
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.7
PRK10698222 phage shock protein PspA; Provisional 84.56
COG1322448 Predicted nuclease of restriction endonuclease-lik 84.26
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 84.0
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 83.95
TIGR006061311 rad50 rad50. This family is based on the phylogeno 83.66
TIGR02559158 HrpB7 type III secretion protein HrpB7. This famil 83.57
KOG0963629 consensus Transcription factor/CCAAT displacement 83.43
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 83.39
PF10174775 Cast: RIM-binding protein of the cytomatrix active 83.38
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 83.37
TIGR02231 525 conserved hypothetical protein. This family consis 83.34
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 83.32
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 83.26
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 83.18
PF11594106 Med28: Mediator complex subunit 28; InterPro: IPR0 83.17
KOG2129552 consensus Uncharacterized conserved protein H4 [Fu 82.65
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 82.64
KOG1962216 consensus B-cell receptor-associated protein and r 82.59
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 82.58
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 82.48
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 82.29
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 82.19
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 82.05
PF09486158 HrpB7: Bacterial type III secretion protein (HrpB7 82.0
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 82.0
PF00038312 Filament: Intermediate filament protein; InterPro: 81.96
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 81.87
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 81.62
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 81.53
PF10158131 LOH1CR12: Tumour suppressor protein; InterPro: IPR 81.39
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 80.97
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 80.84
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 80.76
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 80.71
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 80.43
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 80.39
PF09798 654 LCD1: DNA damage checkpoint protein; InterPro: IPR 80.32
>PF02671 PAH: Paired amphipathic helix repeat; InterPro: IPR003822 This family contains the paired amphipathic helix (PAH) repeat Back     alignment and domain information 
Probab=96.91  E-value=0.0026  Score=45.26  Aligned_cols=46  Identities=17%  Similarity=0.363  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHHHHHhhccccHHHHHHhhhhhcCCCChhHHHHHHHhh
Q 019982          282 YEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLI  328 (333)
Q Consensus       282 YEQFsaFLANIKELNAhkQTREETL~KAeeIFG~~NkdLY~~FegLL  328 (333)
                      .|.|.+||..++.++.++.+++|...++.++|+. |+||...|...|
T Consensus         1 p~~Y~~FL~il~~y~~~~~~~~~v~~~v~~Ll~~-hpdLl~~F~~Fl   46 (47)
T PF02671_consen    1 PEVYNEFLKILNDYKKGRISRSEVIEEVSELLRG-HPDLLEEFNRFL   46 (47)
T ss_dssp             HHHHHHHHHHHHHHHCTCSCHHHHHHHHHHHTTT--HHHHHHHHHHS
T ss_pred             ChHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHcc-CHHHHHHHHhhC
Confidence            3789999999999999999999999999999996 899999998764

The family contains the eukaryotic Sin3 proteins, which have at least three PAH domains (PAH1, PAH2, and PAH3). Sin3 proteins are components of a co-repressor complex that silences transcription, playing important roles in the transition between proliferation and differentiation. Sin3 proteins are recruited to the DNA by various DNA-binding transcription factors such as the Mad family of repressors, Mnt/Rox, PLZF, MeCP2, p53, REST/NRSF, MNFbeta, Sp1, TGIF and Ume6 []. Sin3 acts as a scaffold protein that in turn recruits histone-binding proteins RbAp46/RbAp48 and histone deacetylases HDAC1/HDAC2, which deacetylate the core histones resulting in a repressed state of the chromatin []. The PAH domains are protein-protein interaction domains through which Sin3 fulfils its role as a scaffold. The PAH2 domain of Sin3 can interact with a wide range of unrelated and structurally diverse transcription factors that bind using different interaction motifs. For example, the Sin3 PAH2 domain can interact with the unrelated Mad and HBP1 factors using alternative interaction motifs that involve binding in opposite helical orientations [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1S5Q_B 2L9S_B 1G1E_B 1S5R_B 2CR7_A 2CZY_A 2LD7_B 2RMR_A 2RMS_A 1PD7_A ....
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>COG5602 SIN3 Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG3990 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4010 consensus Coiled-coil protein TPD52 [General function prediction only] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG4398 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>KOG4204 consensus Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF04201 TPD52: Tumour protein D52 family; InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02559 HrpB7 type III secretion protein HrpB7 Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF11594 Med28: Mediator complex subunit 28; InterPro: IPR021640 Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF09798 LCD1: DNA damage checkpoint protein; InterPro: IPR018622 This is a family of proteins which regulate checkpoint kinases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 62.2 bits (150), Expect = 9e-11
 Identities = 52/405 (12%), Positives = 113/405 (27%), Gaps = 106/405 (26%)

Query: 12  FDLPE------EVLQVLPSDPF-EQLDV--ARKITSIAISTRVSD--LESEHSALRSQ-- 58
           F+  E      ++L V   D F +  D    + +    +S    D  + S+ +   +   
Sbjct: 9   FETGEHQYQYKDILSVF-EDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRL 67

Query: 59  ---LAEKDSRIAE------LQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQ 109
              L  K   + +      L+   + + S +  +  Q         ++ + L N  +   
Sbjct: 68  FWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVF- 126

Query: 110 RDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNDDAAV---APTGTSSV-------H 159
              +K  V R      L+        A    +P  N    +     +G + V       +
Sbjct: 127 ---AKYNVSRLQPYLKLRQ-------ALLELRPAKN--VLIDGVLGSGKTWVALDVCLSY 174

Query: 160 SQISEGGNS----SFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSP-- 213
               +        +      PE+    + +         T R     +      S+    
Sbjct: 175 KVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAEL 234

Query: 214 ----TKTPKP--------VSPRRHSISFS-------TSRGMFDDRS--SILSSVHSSHSS 252
                  P          V   +   +F+       T+R     +     LS+  ++H S
Sbjct: 235 RRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTR----FKQVTDFLSAATTTHIS 290

Query: 253 ISSSESGSQTGKTRVDGKEFFRQVRN----RLSYE-------QFAIFLANVKELNAH--- 298
           +           T  + K    +  +     L  E       + +I   ++++  A    
Sbjct: 291 LDHHSMTL----TPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDN 346

Query: 299 -KQTKEETLRKTDEVF-----GPENKDLY---TIF-EGL-ITRNV 332
            K    + L    E         E + ++   ++F     I   +
Sbjct: 347 WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTIL 391
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
2ld7_B75 Paired amphipathic helix protein SIN3A; transcript 97.92
2cr7_A80 Paired amphipathic helix protein SIN3B; paired amp 97.35
2czy_A77 Paired amphipathic helix protein SIN3B; SIN3, PAH1 96.97
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 96.71
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 96.23
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.61
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.48
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 95.43
1e91_A85 Paired amphipathic helix protein SIN3B; eukaryotic 95.18
1g1e_B89 SIN3A; four-helix bundle, protein-peptide complex, 95.05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.68
2v4h_A110 NF-kappa-B essential modulator; transcription, met 94.66
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.46
2f05_A105 Paired amphipathic helix protein SIN3B; helix bund 93.87
3bas_A89 Myosin heavy chain, striated muscle/general contro 93.42
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 93.09
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 92.68
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 92.36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.12
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.07
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 91.9
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 91.83
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 91.81
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 91.27
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 91.21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.14
2akf_A32 Coronin-1A; coiled coil, protein binding; 1.20A {S 91.12
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 91.11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 90.87
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 90.36
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 89.91
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 89.44
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 88.92
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 88.73
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 88.45
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 88.42
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 88.28
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 88.25
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 87.9
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.47
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 87.2
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 87.13
2q6q_A74 Spindle POLE BODY component SPC42; SPC42P, budding 87.07
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 86.99
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 86.73
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.5
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 86.5
4fm3_A98 Uncharacterized hypothetical protein; PF14346 fami 86.04
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 85.94
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 85.76
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 85.29
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 84.83
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 84.11
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 83.84
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 83.33
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 82.78
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 82.71
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 82.37
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 81.24
4dci_A150 Uncharacterized protein; PSI-biology, midwest cent 80.99
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 80.89
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 80.88
1x4t_A92 Hypothetical protein LOC57905; structural genomics 80.11
>2ld7_B Paired amphipathic helix protein SIN3A; transcription; NMR {Mus musculus} Back     alignment and structure
Probab=97.92  E-value=3.2e-05  Score=60.23  Aligned_cols=65  Identities=22%  Similarity=0.343  Sum_probs=61.3

Q ss_pred             CccchHHHHHHHHhcc-CHHHHHHHHHHHHHHhhccccHHHHHHhhhhhcCCCChhHHHHHHHhhcc
Q 019982          265 TRVDGKEFFRQVRNRL-SYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITR  330 (333)
Q Consensus       265 ~rVDGKEFFRQARsRL-SYEQFsaFLANIKELNAhkQTREETL~KAeeIFG~~NkdLY~~FegLL~R  330 (333)
                      ...|.-.||.+||.|| +-+-|..||--++-+|.+.-+|.|.+..+..+|| .|+||+..|..+|..
T Consensus         7 ~~~de~~Ff~kVK~~l~~~~~Y~eFLk~lnlf~q~~Id~~eLv~~V~~~lg-~~pdL~~~Fk~Fl~~   72 (75)
T 2ld7_B            7 GVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLG-KFPELFNWFKNFLGY   72 (75)
T ss_dssp             TSSHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHTTCSCHHHHHHHTHHHHT-TCHHHHHHHHHHHTC
T ss_pred             ccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhhhcCcCHHHHHHHHHHHHc-cCHHHHHHHHHHcCC
Confidence            6679999999999999 8899999999999999999999999999999999 599999999999864
>2cr7_A Paired amphipathic helix protein SIN3B; paired amphipathic helix repeat, transcriptional repressor, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rmr_A 2rms_A Back     alignment and structure
>2czy_A Paired amphipathic helix protein SIN3B; SIN3, PAH1, transcriptional repressor, gene regulation; NMR {Mus musculus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1e91_A Paired amphipathic helix protein SIN3B; eukaryotic transcriptional regulation, SIN3, PAH domains, protein-protein interactions; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1pd7_A Back     alignment and structure
>1g1e_B SIN3A; four-helix bundle, protein-peptide complex, transcription; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1s5q_B 1s5r_B 2l9s_B Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2f05_A Paired amphipathic helix protein SIN3B; helix bundle, transcription repressor; NMR {Mus musculus} SCOP: a.59.1.1 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>4fm3_A Uncharacterized hypothetical protein; PF14346 family protein, DUF4398, structural genomics, joint for structural genomics, JCSG; HET: PG4; 2.47A {Pseudomonas aeruginosa} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>1x4t_A Hypothetical protein LOC57905; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.2.15.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
d2f05a185 Sin3B {Mouse (Mus musculus) [TaxId: 10090]} 96.86
d1s5qb_89 Sin3A {Mouse (Mus musculus) [TaxId: 10090]} 96.16
d1yf2a2205 Bipartite methylase S protein MJ0130 {Methanocaldo 89.59
d1ydxa2181 Bipartite methylase S protein MG438 {Mycoplasma ge 84.85
d1ydxa1193 Bipartite methylase S protein MG438 {Mycoplasma ge 80.55
>d2f05a1 a.59.1.1 (A:1-85) Sin3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: PAH2 domain
superfamily: PAH2 domain
family: PAH2 domain
domain: Sin3B
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.86  E-value=0.0013  Score=49.74  Aligned_cols=60  Identities=17%  Similarity=0.405  Sum_probs=53.4

Q ss_pred             chHHHHHHHHhcc--CHHHHHHHHHHHHHHhhcc----------ccHHHHHHhhhhhcCCCChhHHHHHHHhh
Q 019982          268 DGKEFFRQVRNRL--SYEQFAIFLANVKELNAHK----------QTKEETLRKTDEVFGPENKDLYTIFEGLI  328 (333)
Q Consensus       268 DGKEFFRQARsRL--SYEQFsaFLANIKELNAhk----------QTREETL~KAeeIFG~~NkdLY~~FegLL  328 (333)
                      |...|++.+|.|+  -.|.|..||.-.+.+.+++          .+..|.+..+.+|||. |+||...|...|
T Consensus         9 dA~~yl~kVK~rf~~~p~~Y~~FL~il~~f~~~~i~~~~~~~~~~~~~ev~~~V~~Lf~~-hpdLl~~F~~FL   80 (85)
T d2f05a1           9 NAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRG-QEDLLSEFGQFL   80 (85)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHSSSSSSSSCCCCHHHHHHHHHHHTTT-CHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhhccccccccccCCHHHHHHHHHHHHcc-CHHHHHHHHHHC
Confidence            5778999999999  4789999999999998875          4889999999999975 799999998876
>d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yf2a2 d.287.1.2 (A:221-425) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ydxa2 d.287.1.2 (A:194-374) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure