Citrus Sinensis ID: 019985

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MNDLFSGSFSRFRSEQASPDRPHHHTTIQMTENPNSTGGVNLDKFFDDVESVKDELKELERLHNSLQTSHEKSKTLHNAKAVKDLRSRMDADVSAALKNAKLIKIRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNELRQRISSEYRDTVQRRYYTVTGENPDEKTLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKVLEKNLQELHQVFLDMAVLVQAQGEQLDDIESQVQRANSYVRGGTERLQTARKYQLSTRKWTCIAITILLIIILFVVLFTVKPWDNGGGNGGGGSSPQNPTPQAQTPPS
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
********************************************FFDDVESVKDELKELERLHNSLQ************************DVSAALKNAKLIKIRL***************************SVVNGLRKKLKDSMESFNE*************QRRYYTV*********************FLQKAIQEQGRGRILDTINEIQERHDAVKVLEKNLQELHQVFLDMAVLVQAQGEQLDDIESQVQRANSYVRGGTERLQTARKYQLSTRKWTCIAITILLIIILFVVLFTVKPWD************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDLFSGSFSRFRSEQASPDRPHHHTTIQMTENPNSTGGVNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHEKSKTLHNAKAVKDLRSRMDADVSAALKNAKLIKIRLEALDRSNAANRSLPGCGPGSSSDRTRTSVxxxxxxxxxxxxxxxxxxxxxISSEYRDTVQRRYYTVTGENPDEKTLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKVLEKNLQELHQVFLDMAVLVQAQGEQLDDIESQVQRANSYVRGGTERLQTARKYQLSTRKWTCIAITILLIIILFVVLFTVKPWDNGGGNGGGGSSPQNPTPQAQTPPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-121 Vesicle trafficking protein that functions in the secretory pathway.confidentQ9ZSD4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHE, chain B
Confidence level:very confident
Coverage over the Query: 37-190,213-264
View the alignment between query and template
View the model in PyMOL
Template: 3HD7, chain B
Confidence level:very confident
Coverage over the Query: 209-285
View the alignment between query and template
View the model in PyMOL