Citrus Sinensis ID: 020021


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MVGSQSEREDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGAYVGRK
cccccccccCEEEEEEcHHHcccEEEEEEEccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEccccccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEECcccccEEEEEcccccEEEEEECccCEEEECccccEEEEEEccccEEEEEcccccccccEEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEEEccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEccccccccEEEEEcccccEEEEcccccEEEcccccccccccccc
*******REDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGA*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGSQSEREDKVSLELSEEILQSMEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGAYVGRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized WD repeat-containing protein C824.04 probableQ9UT39
WD repeat-containing protein 82 Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Possible role in telomere length maintenance and in mRNA processing.probableQ8BFQ4
WD repeat-containing protein 82 Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus.probableQ5ZMV7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 14-279
View the alignment between query and template
View the model in PyMOL
Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 24-319
View the alignment between query and template
View the model in PyMOL