Citrus Sinensis ID: 020026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccc
**************************VQYRIPDDMDL********************FCS********************************************************************************************YISELERKVQTLQTEATTLSAQLTLFQRDTTDLST*N********************************************YNLGMQPIPYNQSLFY***********************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLFQRDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor RF2b Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.probableQ6S4P4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WT7, chain A
Confidence level:confident
Coverage over the Query: 129-185
View the alignment between query and template
View the model in PyMOL
Template: 2WT7, chain B
Confidence level:confident
Coverage over the Query: 115-199
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 155-225
View the alignment between query and template
View the model in PyMOL