Citrus Sinensis ID: 020026

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHHHcccHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccHHHHHHccccccccccEcccccccEEccccccEEEccccccc
mesqdppnpnpnpptrgpyhrrsqsevqyripddmdlvsdpisdplfdgpggseddlfcsymdmdkigskptgddpkhenanvsvgarprhrysnsidgttsssSVLESIeakkamdpdklaelwtvdpkRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFqrdttdlstENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVAtgemmtptdtynlgmqpipynqslfyphhpqtgpgdtqivqlpefhpfqpnmstphqpmlataNSHAFSEMlqqdplgrlqgldingrnshlvksegpsisasessstf
mesqdppnpnpnpptrgpyhrrSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGskptgddpkhenanvsvgarprhrysnsidgttssssVLESIEakkamdpdklaelwtvdpkraksrilanrqsaarskerkaRYISELERKVQTLQTEATtlsaqltlfqrdttdLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNshlvksegpsisasessstf
MESQDppnpnpnppTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGttssssVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKsegpsisasesssTF
*********************************************************FCS******************************************************************************************************************LTLF*****************************************************DTYNLGMQPIPYNQSLFYP**********************************************************************************
***********************QSEVQYRIPDDMDL*******************************************************************************************************************YISELERKVQTLQTEATTLSAQLTLFQRDTTDLST*N***********************************************************************************************************************************************
**************************VQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKSR****************RYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHL*****************
******************************IPDDMDLVS************GSEDDLFCSYMDMDKI*********************************************K**MDPDKLAELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPT**YNLGMQPIPYNQSLFY***********************************************QDPLGRLQGLDINGRNS*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLFQRDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q6S4P4329 Transcription factor RF2b yes no 0.882 0.890 0.551 3e-80
Q04088398 Probable transcription fa no no 0.704 0.587 0.487 2e-52
Q69IL4380 Transcription factor RF2a no no 0.635 0.555 0.514 1e-51
Q9MA75341 Transcription factor VIP1 no no 0.409 0.398 0.635 2e-42
P23922349 Transcription factor HBP- N/A no 0.225 0.214 0.32 0.0001
Q54Q90 530 Probable basic-leucine zi yes no 0.246 0.154 0.348 0.0004
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function desciption
 Score =  298 bits (764), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 230/319 (72%), Gaps = 26/319 (8%)

Query: 4   QDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMD 63
           Q+P + +P    RG +HRR++SEV +R+PDD+DL         FD   GSEDDLF ++MD
Sbjct: 2   QEPKHTDP-AAMRGAHHRRARSEVAFRLPDDLDLGGGGAGA--FD-EIGSEDDLFSTFMD 57

Query: 64  MDKIGSKPT--GDDPKHENANVSVGARPRHRYSNSIDGT--------TSSSSVLESIEAK 113
           ++KI S P   G   +   A  S   RP+HR+S+S+DG+         +++S+ E +EAK
Sbjct: 58  IEKISSGPAAAGGSDRDRAAETSSPPRPKHRHSSSVDGSGFFAAARKDAAASLAEVMEAK 117

Query: 114 KAMDPDKLAELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSA 173
           KAM P++L++L  +DPKRAK RILANRQSAARSKERKARYI+ELERKVQTLQTEATTLSA
Sbjct: 118 KAMTPEQLSDLAAIDPKRAK-RILANRQSAARSKERKARYITELERKVQTLQTEATTLSA 176

Query: 174 QLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDT 233
           QLTLFQRDTT LS EN ELK+RLQAMEQQAQLRDALN+ALK+E+ERLK+ATGEM    +T
Sbjct: 177 QLTLFQRDTTGLSAENAELKIRLQAMEQQAQLRDALNDALKQELERLKLATGEMTNSNET 236

Query: 234 YNLGMQPIPYNQSLFYP---HHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHA 290
           Y++G+Q +PYN + F+P   H+     G TQ+   P+F P +PN+     P    ++ + 
Sbjct: 237 YSMGLQHVPYN-TPFFPLAQHNAARQNGGTQLP--PQFQPPRPNV-----PNHMLSHPNG 288

Query: 291 FSEMLQQDPLGRLQGLDIN 309
             +++QQDPLGRLQGLDI+
Sbjct: 289 LQDIMQQDPLGRLQGLDIS 307
Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q54Q90|BZPL_DICDI Probable basic-leucine zipper transcription factor L OS=Dictyostelium discoideum GN=bzpL PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
225448679359 PREDICTED: transcription factor RF2b [Vi 0.969 0.896 0.657 1e-119
255559691355 Transcription factor RF2b, putative [Ric 0.918 0.859 0.633 1e-113
147769462412 hypothetical protein VITISV_012579 [Viti 0.972 0.783 0.570 1e-111
449457399344 PREDICTED: transcription factor RF2b-lik 0.957 0.924 0.631 1e-106
307135840335 b-zip DNA binding protein [Cucumis melo 0.930 0.922 0.636 1e-104
147770946342 hypothetical protein VITISV_035032 [Viti 0.936 0.909 0.639 1e-103
225434335344 PREDICTED: transcription factor RF2b-lik 0.939 0.906 0.638 1e-103
224126595318 predicted protein [Populus trichocarpa] 0.897 0.937 0.641 1e-103
356553170362 PREDICTED: transcription factor RF2b [Gl 0.891 0.817 0.625 4e-99
449444530396 PREDICTED: transcription factor RF2b-lik 0.939 0.787 0.628 6e-99
>gi|225448679|ref|XP_002280180.1| PREDICTED: transcription factor RF2b [Vitis vinifera] Back     alignment and taxonomy information
 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 240/365 (65%), Positives = 277/365 (75%), Gaps = 43/365 (11%)

Query: 4   QDPPNPNP--------NPPT----------RGPYHRRSQSEVQYRIPDDMDLVSDPISDP 45
           QDP NPNP         PP+          RG +HRR+ SEV +RIP+D+ LVSDP    
Sbjct: 2   QDPSNPNPISHSHNAHQPPSTSFPNTATSLRGGHHRRAHSEVNFRIPEDLHLVSDP---- 57

Query: 46  LFDGPG------GSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGA---------RPR 90
            FD P       GSEDDLFC+Y+D+DK GS+P GD  + +NA   + A         RPR
Sbjct: 58  -FDVPSASFEEMGSEDDLFCTYIDIDKFGSRPEGD-ARIDNAGGGLAAESGDGEKSSRPR 115

Query: 91  HRYSNSIDGTTSS---SSVLESIEAKKAMDPDKLAELWTVDPKRAKSRILANRQSAARSK 147
           HR+SNS+DG++ S   S  +++IEAKKAM PDKLAELWT+DPKRAK RILANRQSAARSK
Sbjct: 116 HRHSNSVDGSSMSRGESLFVDTIEAKKAMAPDKLAELWTLDPKRAK-RILANRQSAARSK 174

Query: 148 ERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRD 207
           ERKARYI ELERKVQTLQTEATTLSAQLTLFQRDTT L+TENTELKLRLQAMEQQAQLRD
Sbjct: 175 ERKARYILELERKVQTLQTEATTLSAQLTLFQRDTTGLTTENTELKLRLQAMEQQAQLRD 234

Query: 208 ALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPE 267
           ALNEALKKEVERLK+ATGE+MT +D YNLGM  +PY QS F+ H  Q GP ++Q +Q+P+
Sbjct: 235 ALNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPGPSESQNIQMPQ 294

Query: 268 FHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASE 327
           FHPF  NM T HQP+L  A+S+A S+MLQQDPLGRLQGLDI+ R   LVKSEGPSISASE
Sbjct: 295 FHPFPSNMLTHHQPLLGAAHSNALSDMLQQDPLGRLQGLDISSRGPSLVKSEGPSISASE 354

Query: 328 SSSTF 332
           SSSTF
Sbjct: 355 SSSTF 359

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255559691|ref|XP_002520865.1| Transcription factor RF2b, putative [Ricinus communis] gi|223539996|gb|EEF41574.1| Transcription factor RF2b, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147769462|emb|CAN70347.1| hypothetical protein VITISV_012579 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457399|ref|XP_004146436.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307135840|gb|ADN33710.1| b-zip DNA binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|147770946|emb|CAN65087.1| hypothetical protein VITISV_035032 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225434335|ref|XP_002266792.1| PREDICTED: transcription factor RF2b-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126595|ref|XP_002319876.1| predicted protein [Populus trichocarpa] gi|222858252|gb|EEE95799.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553170|ref|XP_003544931.1| PREDICTED: transcription factor RF2b [Glycine max] Back     alignment and taxonomy information
>gi|449444530|ref|XP_004140027.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.75 0.678 0.642 1.1e-78
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.837 0.824 0.519 7.4e-66
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.683 0.570 0.5 5e-44
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.400 0.240 0.641 2e-41
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.484 0.380 0.572 6.8e-40
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.433 0.422 0.611 1.5e-37
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.346 0.219 0.655 2.6e-36
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.325 0.336 0.463 1.1e-18
TAIR|locus:2057030264 AT2G12900 "AT2G12900" [Arabido 0.352 0.443 0.394 2.8e-18
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.280 0.282 0.510 5.5e-18
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 791 (283.5 bits), Expect = 1.1e-78, P = 1.1e-78
 Identities = 178/277 (64%), Positives = 202/277 (72%)

Query:    16 RGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGS------ 69
             RGPYHRR+ SEVQ+R+P+D+DL S+P     FD  G SEDDLFCSYMD++K+GS      
Sbjct:    30 RGPYHRRAHSEVQFRLPEDLDL-SEPFGG--FDELG-SEDDLFCSYMDIEKLGSGSGSAS 85

Query:    70 ------KPTGDDP-KHENANVSVG-ARPRHRYSNSIDGXXXXXXVLESIEAKKAMDPDKL 121
                    P  D+P   EN     G +RPRHR+S S+DG       LESIEAKKAM PDKL
Sbjct:    86 DSAGPSAPRSDNPFSAENGGAEAGNSRPRHRHSLSVDGSST----LESIEAKKAMAPDKL 141

Query:   122 AELWTVDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRD 181
             AELW VDPKRAK RI+ANRQSAARSKERKARYI ELERKVQTLQTEATTLSAQL+LFQRD
Sbjct:   142 AELWVVDPKRAK-RIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRD 200

Query:   182 TTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPI 241
             TT LS+ENTELKLRLQ MEQQA+LRDALNE LKKEVERLK ATGE+ +P D YNLGM  +
Sbjct:   201 TTGLSSENTELKLRLQVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHM 259

Query:   242 PYNQS---LFYPHHPQTGPGDTQIVQLP-EFHPFQPN 274
              Y Q     F+ HH Q       + Q+  +FH FQPN
Sbjct:   260 QYQQQPQQSFFQHHHQQQTDAQNLQQMTHQFHLFQPN 296
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6S4P4RF2B_ORYSJNo assigned EC number0.55170.88250.8905yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029442001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (359 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
smart0033865 smart00338, BRLZ, basic region leucin zipper 6e-13
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 7e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-05
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 0.001
pfam08614194 pfam08614, ATG16, Autophagy protein 16 (ATG16) 0.002
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 62.6 bits (153), Expect = 6e-13
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 128 DPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLST 187
           D KR + R   NR++A RS+ERK   I ELERKV+ L+ E   L  ++   +R+   L +
Sbjct: 3   DEKRRR-RRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKS 61

Query: 188 ENTE 191
           E  E
Sbjct: 62  ELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
smart0033865 BRLZ basic region leucin zipper. 99.41
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.31
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.09
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.01
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 98.98
KOG3584348 consensus cAMP response element binding protein an 98.78
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.77
KOG0837279 consensus Transcriptional activator of the JUN fam 97.99
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 97.9
KOG4571294 consensus Activating transcription factor 4 [Trans 97.36
KOG3119269 consensus Basic region leucine zipper transcriptio 96.7
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.68
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.38
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.34
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.25
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.83
PRK13169110 DNA replication intiation control protein YabA; Re 95.68
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.17
PRK10884206 SH3 domain-containing protein; Provisional 94.4
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 94.35
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 94.31
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.3
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.85
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.41
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.28
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.16
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.08
COG4467114 Regulator of replication initiation timing [Replic 92.9
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.73
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 92.56
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 92.55
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.51
PRK0029568 hypothetical protein; Provisional 92.24
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 91.98
PRK0073668 hypothetical protein; Provisional 91.94
PRK0279372 phi X174 lysis protein; Provisional 91.88
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.87
PRK0432574 hypothetical protein; Provisional 91.78
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.56
TIGR0244965 conserved hypothetical protein TIGR02449. Members 91.54
PRK0211973 hypothetical protein; Provisional 91.52
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.46
COG2433652 Uncharacterized conserved protein [Function unknow 91.44
PF1374789 DUF4164: Domain of unknown function (DUF4164) 91.36
PRK11637428 AmiB activator; Provisional 91.34
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.33
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 91.31
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 91.27
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.24
PRK0440675 hypothetical protein; Provisional 91.21
PF10186302 Atg14: UV radiation resistance protein and autopha 91.14
PRK11637428 AmiB activator; Provisional 91.05
PRK1542279 septal ring assembly protein ZapB; Provisional 90.73
PRK10884206 SH3 domain-containing protein; Provisional 90.23
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.17
PRK0084677 hypothetical protein; Provisional 90.09
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 89.74
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 89.71
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.69
COG4942 420 Membrane-bound metallopeptidase [Cell division and 89.51
PRK09039343 hypothetical protein; Validated 88.55
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 88.54
PRK04863 1486 mukB cell division protein MukB; Provisional 88.37
COG307479 Uncharacterized protein conserved in bacteria [Fun 88.22
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 88.21
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 88.12
PRK09039343 hypothetical protein; Validated 88.11
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 87.89
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 87.88
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.85
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 87.59
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.46
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 87.29
KOG3650120 consensus Predicted coiled-coil protein [General f 87.26
KOG0288 459 consensus WD40 repeat protein TipD [General functi 87.07
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 86.98
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.94
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 86.89
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 86.86
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 86.7
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 86.36
KOG4807593 consensus F-actin binding protein, regulates actin 86.35
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 86.26
PF00038312 Filament: Intermediate filament protein; InterPro: 85.99
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 85.96
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 85.91
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 85.84
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 85.76
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 85.72
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 85.55
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.46
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 85.45
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 85.44
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 85.35
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 85.18
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 85.14
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 85.01
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 84.93
COG4026290 Uncharacterized protein containing TOPRIM domain, 84.73
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 84.64
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 84.64
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 84.61
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.57
PRK1542279 septal ring assembly protein ZapB; Provisional 84.35
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 83.97
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.94
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 83.77
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 83.73
PHA02562562 46 endonuclease subunit; Provisional 83.53
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 83.22
KOG1962216 consensus B-cell receptor-associated protein and r 83.15
PRK10698222 phage shock protein PspA; Provisional 83.02
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.69
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 82.66
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.43
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 82.4
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 82.34
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 82.15
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 81.97
COG2433652 Uncharacterized conserved protein [Function unknow 81.88
PRK05431 425 seryl-tRNA synthetase; Provisional 81.63
TIGR02977219 phageshock_pspA phage shock protein A. Members of 81.29
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 80.89
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 80.82
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 80.38
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 80.27
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 80.16
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 80.1
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 80.07
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.41  E-value=1.5e-12  Score=98.36  Aligned_cols=62  Identities=40%  Similarity=0.546  Sum_probs=56.4

Q ss_pred             CChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q 020026          127 VDPKRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTEN  189 (332)
Q Consensus       127 ~DpKR~K~RiLaNReSA~RSReRKkqyieeLE~kVq~Lq~ENs~Ls~ql~~Lqr~~~~L~sEN  189 (332)
                      .|+|+.| |+++||+||++||+||+.|+.+||.+|+.|+.+|..|..++..|..++..|..++
T Consensus         2 ~~~k~~r-R~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        2 EDEKRRR-RRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             ccHHHHH-HHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4789999 9999999999999999999999999999999999999999998877766666554

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 9e-10
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 1e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 1e-06
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 3e-06
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 7e-06
2wt7_B90 Transcription factor MAFB; transcription, transcri 9e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-04
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
 Score = 53.1 bits (128), Expect = 9e-10
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 130 KRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTEN 189
           KR K  +  NR +A+RS++++  ++  LE+K + L +    L +++       T L  E 
Sbjct: 1   KRRK-FLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEV-------TLLRNEV 52

Query: 190 TELKLRLQA 198
            +LK  L A
Sbjct: 53  AQLKQLLLA 61
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.49
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.32
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.29
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.15
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.02
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.93
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.87
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.41
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.38
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.15
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.09
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.28
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 95.33
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.99
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 94.63
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.76
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.75
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.76
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 92.65
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.65
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.26
3cve_A72 Homer protein homolog 1; coiled coil, alternative 90.98
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 90.82
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.7
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 90.7
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 90.32
1deb_A54 APC protein, adenomatous polyposis coli protein; c 90.27
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 89.17
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 89.14
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.12
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 89.05
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 88.75
3m48_A33 General control protein GCN4; leucine zipper, synt 88.52
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 88.14
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.11
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 87.87
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 87.85
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 87.74
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 87.48
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 87.14
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 86.89
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 86.88
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 86.73
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 86.48
4ath_A83 MITF, microphthalmia-associated transcription fact 86.35
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 86.26
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 86.18
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 85.91
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 85.51
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.42
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 85.12
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 85.04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 84.86
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 84.68
2hy6_A34 General control protein GCN4; protein design, para 84.62
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 84.56
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.45
2bni_A34 General control protein GCN4; four helix bundle, a 84.11
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 83.73
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 83.34
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 83.3
1uo4_A34 General control protein GCN4; four helix bundle, c 83.23
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 82.86
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 82.54
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 82.45
1fmh_A33 General control protein GCN4; coiled coil, leucine 81.39
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 80.75
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 80.71
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 80.64
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 80.62
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 80.55
4ati_A118 MITF, microphthalmia-associated transcription fact 80.51
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 80.5
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.49  E-value=3.4e-14  Score=105.03  Aligned_cols=52  Identities=31%  Similarity=0.514  Sum_probs=48.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 020026          130 KRAKSRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDT  182 (332)
Q Consensus       130 KR~K~RiLaNReSA~RSReRKkqyieeLE~kVq~Lq~ENs~Ls~ql~~Lqr~~  182 (332)
                      ||.+ |+++||+||++||+||++|+++||.+|..|+.||..|..++..|+..+
T Consensus         1 kr~r-R~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREV-RLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHH-HHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6888 999999999999999999999999999999999999999999887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 80.46
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=80.46  E-value=0.38  Score=35.79  Aligned_cols=26  Identities=15%  Similarity=0.289  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 020026          130 KRAKSRILANRQSAARSKERKARYISE  156 (332)
Q Consensus       130 KR~K~RiLaNReSA~RSReRKkqyiee  156 (332)
                      +-+| |.=+|+.+|+++|.||....++
T Consensus        48 rDIR-RRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          48 RKIR-RRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHH-HHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHH-HhcccHHHHHHHHHhhhhhhcc
Confidence            5677 8889999999999999876654