Citrus Sinensis ID: 020031

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--

MLLDAGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGEGGSGFAAAAAAAAASGASGYEFGVDPNLDPELALALRVSMEEERARQEAAAKRAAEEAAKKEKQGEQQSSSQDVTMTDQDSVPASEADDKKKTTKHDEGLLQEAIAMSSTPSYPSGRDTNMSEVAEDDPELALALQLSMQDGTKDAPSHSDMSQLLADQAFVSSILASLPGVDPEDPSVKDVLTSMQNQSEPQEKKDEDKVSKEEEEKK

cccccccccccCECHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccHHHHcc

*****GLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGE**SGF************SGYEFGVDPNLDPELALALRV***********************************************************************************************************************DQAFVSSILASLPGVDPEDP********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLLDAGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGEGGSGFAAAAAAAAASGASGYEFGVDPNLDPELALALxxxxxxxxxxxxxxxxxxxxxxxxxxxxGEQQSSSQDVTMTDQDSVPASEADDKKKTTKHDEGLLQEAIAMSSTPSYPSGRDTNMSEVAEDDPELALALQLSMQDGTKDAPSHSDMSQLLADQAFVSSILASLPGVDPEDPSVKDVLTSMQNQSEPQEKKDEDKVSKEEEEKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
26S proteasome non-ATPase regulatory subunit 4	Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins. Plays a role in the growth and development via the proteasome-dependent degradation of the ABA-signaling protein ABI5/DPBF1.	probable	P55034

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain W
Confidence level:very confident
Coverage over the Query: 2-121
View the alignment between query and template
View the model in PyMOL

Template: 1YX4, chain A
Confidence level:very confident
Coverage over the Query: 137-266
View the alignment between query and template
View the model in PyMOL