Citrus Sinensis ID: 020039


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANKQEDD
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEccEEEEEEEEccEEEEEEEEcccccccccHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccc
*************************************************CPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDE****************************SLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHS**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANKQEDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromatin modification-related protein eaf3 Involved in deacetylation of histones, chromatin assembly and chromosome segregation. May act as a transcriptional oscillator, directing histone deacetylases to specific chromosomal domains. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair.probableQ5BBV4
Chromatin modification-related protein eaf3 Involved in deacetylation of histones, chromatin assembly and chromosome segregation. May act as a transcriptional oscillator, directing histone deacetylases to specific chromosomal domains. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair.probableQ4WPW2
Mortality factor 4-like protein 1 Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.probableQ5NVP9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y0N, chain A
Confidence level:very confident
Coverage over the Query: 165-319
View the alignment between query and template
View the model in PyMOL
Template: 2F5K, chain A
Confidence level:very confident
Coverage over the Query: 47-123
View the alignment between query and template
View the model in PyMOL