Citrus Sinensis ID: 020039

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANKQEDD
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEccEEEEEEEEccEEEEEEEEcccccccccHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEEEEccccccEEEEEEEccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHccccccccccHHHHHHHcccc
mkmgslnaelnenddhsgsatesdeptntktetdedkekecpcpptpascpyqvnEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMkdteanrhrqpvftkkrdedknlksghalqmkprssnvgrgrkrkndslnketnglqmenfvniqippplkkqlvdDCEFITHlgklvklprtpnvddILEKYCDyrskkdglvadstGEIVKGLRCYFDKALPIMLLYKSEREqyedsmaadvspssvygAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFflsryhsaedvetsankqedd
MKMGSLNAElnenddhsgsatesdeptntktetdedkekecpCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKdteanrhrqpvftkkrdedknlksghalqmkprssnvgrgrkrkndslnketnglqmenfVNIQIPPPLKKQLVDDCEFITHlgklvklprtpnvDDILEKYCdyrskkdglvadstgeivKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFlsryhsaedvetsankqedd
MKMGSLNAELNENDDHSGSATESdeptntktetdedkekeCPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANKQEDD
*************************************************CPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLM**********************************************************ENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKS****************SVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRY****************
****************************************************QVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDE****************************SLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRS********S*GEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHS**************
********************************************PTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQM****************SLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHS**************
************************************************SCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKR****************************************MENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSANKQEDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q6AYU1323 Mortality factor 4-like p yes no 0.804 0.826 0.347 1e-36
Q5BBV4327 Chromatin modification-re yes no 0.807 0.819 0.351 6e-36
Q5NVP9323 Mortality factor 4-like p yes no 0.804 0.826 0.334 1e-35
Q4P827303 Chromatin modification-re N/A no 0.701 0.768 0.334 2e-34
Q4WPW2330 Chromatin modification-re yes no 0.825 0.830 0.331 4e-33
Q6BT38316 Chromatin modification-re yes no 0.765 0.803 0.321 4e-32
Q6C9M9387 Chromatin modification-re yes no 0.695 0.596 0.335 8e-32
P60762362 Mortality factor 4-like p no no 0.804 0.737 0.308 9e-31
Q9UBU8362 Mortality factor 4-like p no no 0.804 0.737 0.308 9e-31
Q54RM0379 NuA4 complex subunit EAF3 yes no 0.496 0.435 0.417 3e-30
>sp|Q6AYU1|MO4L1_RAT Mortality factor 4-like protein 1 OS=Rattus norvegicus GN=Morf4l1 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (388), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 160/311 (51%), Gaps = 44/311 (14%)

Query: 52  YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR 111
           +Q  E+VL F    +YEAK ++V  + K+  + +HY GWNK+WDEWV   R++K  +AN 
Sbjct: 11  FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDANL 70

Query: 112 HRQPVFTKKRDED--------------------KNL--KSGHALQMKPRSSNVG------ 143
            +Q    K   E                     KN+  K+    Q  P + + G      
Sbjct: 71  QKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETP 130

Query: 144 ----RGRKRKNDSL-NKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTP 198
               + R R + ++ N+ET   ++E  V ++IP  LK  LVDD + IT   +L  LP   
Sbjct: 131 QPPRKKRARVDPTVENEETFMNRVE--VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKK 188

Query: 199 NVDDILEKYCDYRSKKDGLVAD--STGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMA- 255
           NVD ILE Y +Y+  +        +  E+V G++ YF+  L   LLYK ER QY + +A 
Sbjct: 189 NVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILAD 248

Query: 256 -ADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLS 314
             D   S VYGA HLLRLFV++  +L +  ++E++L LL + L D LK+L K+ +T F  
Sbjct: 249 HPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLF-- 306

Query: 315 RYHSAEDVETS 325
              SA D E +
Sbjct: 307 ---SASDYEVA 314
Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones.Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.
Rattus norvegicus (taxid: 10116)
>sp|Q5BBV4|EAF3_EMENI Chromatin modification-related protein eaf3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf3 PE=3 SV=1 Back     alignment and function description
>sp|Q5NVP9|MO4L1_PONAB Mortality factor 4-like protein 1 OS=Pongo abelii GN=MORF4L1 PE=2 SV=1 Back     alignment and function description
>sp|Q4P827|EAF3_USTMA Chromatin modification-related protein EAF3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF3 PE=3 SV=1 Back     alignment and function description
>sp|Q4WPW2|EAF3_ASPFU Chromatin modification-related protein eaf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf3 PE=3 SV=1 Back     alignment and function description
>sp|Q6BT38|EAF3_DEBHA Chromatin modification-related protein EAF3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF3 PE=3 SV=1 Back     alignment and function description
>sp|Q6C9M9|EAF3_YARLI Chromatin modification-related protein EAF3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF3 PE=3 SV=1 Back     alignment and function description
>sp|P60762|MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus GN=Morf4l1 PE=2 SV=2 Back     alignment and function description
>sp|Q9UBU8|MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens GN=MORF4L1 PE=1 SV=2 Back     alignment and function description
>sp|Q54RM0|EAF3_DICDI NuA4 complex subunit EAF3 homolog OS=Dictyostelium discoideum GN=DDB_G0283075 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
449447041313 PREDICTED: mortality factor 4-like prote 0.900 0.955 0.603 2e-98
356514437325 PREDICTED: male-specific lethal 3 homolo 0.885 0.904 0.588 1e-94
359492003305 PREDICTED: mortality factor 4-like prote 0.819 0.891 0.597 5e-94
302142251306 unnamed protein product [Vitis vinifera] 0.822 0.892 0.594 1e-93
356510513322 PREDICTED: nuA4 complex subunit EAF3 hom 0.912 0.940 0.580 4e-93
255538164341 chromatin binding protein, putative [Ric 0.879 0.856 0.576 5e-91
224137656272 predicted protein [Populus trichocarpa] 0.780 0.952 0.634 9e-91
255567903318 chromatin binding protein, putative [Ric 0.831 0.867 0.568 2e-89
356511911319 PREDICTED: nuA4 complex subunit EAF3 hom 0.804 0.836 0.582 3e-87
356563568319 PREDICTED: nuA4 complex subunit EAF3 hom 0.819 0.852 0.569 3e-86
>gi|449447041|ref|XP_004141278.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus] gi|449508171|ref|XP_004163239.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 229/305 (75%), Gaps = 6/305 (1%)

Query: 27  TNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVH 86
           T +K ++++D +     PP+   CP+   EKVLAF    +YEAKV++ +Y+LKEW   VH
Sbjct: 15  TTSKNDSEDDDDNGVQNPPS-HPCPFSEGEKVLAFHSFVIYEAKVLKTEYQLKEWRCYVH 73

Query: 87  YLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGR 146
           YLGW+K+WDEWVG+ RL+K TE N  +Q    +KR  DK  K+  A  +KP+  NV +G+
Sbjct: 74  YLGWSKTWDEWVGLDRLLKFTEENVQKQQELNEKRGTDK--KASRASHIKPK--NVVKGK 129

Query: 147 KRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEK 206
           KRKND+ +KE   + +E  V+IQIP  LKKQLVDD EF+THLGKLVKLPRTPNVDDI++K
Sbjct: 130 KRKNDA-SKEKGAMNVEKLVSIQIPVKLKKQLVDDSEFVTHLGKLVKLPRTPNVDDIMKK 188

Query: 207 YCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGA 266
           Y +YR KKD    +S GEIVKGL CYFDKALP+MLLYKSER+QYE+ M  DVSPSS+YGA
Sbjct: 189 YLEYRLKKDATKDESIGEIVKGLICYFDKALPVMLLYKSERQQYEELMINDVSPSSIYGA 248

Query: 267 EHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETSA 326
           EHLLRLFV+LPELL  A IEEETL  LQ KLVDLLKFL+K+Q+ FFLS YH  E++ETS 
Sbjct: 249 EHLLRLFVRLPELLSQANIEEETLMELQQKLVDLLKFLRKNQNAFFLSSYHVPENMETST 308

Query: 327 NKQED 331
           N  +D
Sbjct: 309 NNADD 313

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356514437|ref|XP_003525912.1| PREDICTED: male-specific lethal 3 homolog [Glycine max] Back     alignment and taxonomy information
>gi|359492003|ref|XP_002283143.2| PREDICTED: mortality factor 4-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142251|emb|CBI19454.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510513|ref|XP_003523982.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Back     alignment and taxonomy information
>gi|255538164|ref|XP_002510147.1| chromatin binding protein, putative [Ricinus communis] gi|223550848|gb|EEF52334.1| chromatin binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137656|ref|XP_002327180.1| predicted protein [Populus trichocarpa] gi|222835495|gb|EEE73930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255567903|ref|XP_002524929.1| chromatin binding protein, putative [Ricinus communis] gi|223535764|gb|EEF37426.1| chromatin binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356511911|ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Back     alignment and taxonomy information
>gi|356563568|ref|XP_003550033.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2024725327 AT1G02740 [Arabidopsis thalian 0.837 0.850 0.541 6.2e-78
TAIR|locus:2114980320 AT4G37280 [Arabidopsis thalian 0.843 0.875 0.515 2.7e-75
DICTYBASE|DDB_G0283075379 DDB_G0283075 "NuA4 histone H4 0.575 0.503 0.386 5.3e-45
RGD|2322736324 LOC100360113 "mortality factor 0.611 0.626 0.362 7.4e-40
UNIPROTKB|F1N4R2296 MORF4L1 "Uncharacterized prote 0.804 0.902 0.362 4.8e-39
UNIPROTKB|H0YLJ3269 MORF4L1 "Mortality factor 4-li 0.75 0.925 0.363 3.5e-36
UNIPROTKB|E1BFB6294 E1BFB6 "Uncharacterized protei 0.798 0.901 0.348 1.9e-35
UNIPROTKB|J9P9V5296 MORF4L1 "Uncharacterized prote 0.816 0.915 0.343 5.1e-35
POMBASE|SPAC23H4.12337 alp13 "MRG family Clr6 histone 0.457 0.451 0.339 8.1e-35
CGD|CAL0003490369 EAF3 [Candida albicans (taxid: 0.551 0.495 0.336 9.3e-34
TAIR|locus:2024725 AT1G02740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 784 (281.0 bits), Expect = 6.2e-78, P = 6.2e-78
 Identities = 151/279 (54%), Positives = 201/279 (72%)

Query:    45 PTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLM 104
             P P    ++  E+VLA      YEAKV++V+++  EW + VHY+GWNKSWDEW+ +  L+
Sbjct:    46 PAPPG-HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLL 104

Query:   105 KDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMEN 164
             K ++ N  +Q     K+   K+  +    +MKPRS NV RGRKRK DS++ E N L  +N
Sbjct:   105 KHSDENIEKQKEQGLKQQGIKSAMAWKVSKMKPRSPNVARGRKRKQDSVDTEKNVLPSDN 164

Query:   165 FVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGE 224
              ++  IPP L+KQL+DD EF+T + KLV+LPR+PNVD IL+KY D + KK G V DS  E
Sbjct:   165 LLSFNIPPALRKQLLDDFEFVTQMQKLVQLPRSPNVDGILKKYIDSQMKKHGRVTDSLEE 224

Query:   225 IVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAK 284
             I+KGLRCYFDKALP+MLLY +ER+QYE+S++  VSPS+VYGAEHLLRLFVKLPELLVH  
Sbjct:   225 ILKGLRCYFDKALPVMLLYNNERKQYEESVSGGVSPSTVYGAEHLLRLFVKLPELLVHVN 284

Query:   285 IEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVE 323
             + EETL  LQ   VD+L+FL+K+QS  F+S Y + E++E
Sbjct:   285 MAEETLKELQDNFVDILRFLRKNQSVLFVSTYKAVEEME 323
GO:0005634 "nucleus" evidence=ISM;IEA
TAIR|locus:2114980 AT4G37280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283075 DDB_G0283075 "NuA4 histone H4 acetyltransferase complex subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|2322736 LOC100360113 "mortality factor 4 like 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4R2 MORF4L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLJ3 MORF4L1 "Mortality factor 4-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFB6 E1BFB6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9V5 MORF4L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
POMBASE|SPAC23H4.12 alp13 "MRG family Clr6 histone deacetylase complex subunit Alp13" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0003490 EAF3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4WPW2EAF3_ASPFUNo assigned EC number0.33110.82530.8303yesno
Q6AYU1MO4L1_RATNo assigned EC number0.34720.80420.8266yesno
Q5BBV4EAF3_EMENINo assigned EC number0.35110.80720.8195yesno
Q5NVP9MO4L1_PONABNo assigned EC number0.33440.80420.8266yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.40.964.1
hypothetical protein (272 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
pfam05712191 pfam05712, MRG, MRG 2e-63
pfam1171755 pfam11717, Tudor-knot, RNA binding activity-knot o 4e-09
PLN00104 450 PLN00104, PLN00104, MYST -like histone acetyltrans 0.004
>gnl|CDD|218713 pfam05712, MRG, MRG Back     alignment and domain information 
 Score =  199 bits (507), Expect = 2e-63
 Identities = 85/188 (45%), Positives = 106/188 (56%), Gaps = 12/188 (6%)

Query: 139 SSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTP 198
           SS   RG KRK  S +++ +  + E  V I IP  LKK LVDD E+IT   KLV LP   
Sbjct: 1   SSAPARGTKRKRSSADEKEDNFRSEPRVRINIPDELKKLLVDDWEYITKDKKLVALPARV 60

Query: 199 NVDDILEKYCDYRSKKDGLVADSTG-----EIVKGLRCYFDKALPIMLLYKSEREQYED- 252
            V  ILE Y   R+ K      S       E+V GLR YF+KAL  +LLYK ER QY + 
Sbjct: 61  PVVTILEDYVKERAIKQDSSTSSARMELLEEVVDGLRIYFNKALGDLLLYKFERLQYLEL 120

Query: 253 ------SMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQK 306
                 S  +D  PS +YGAEHLLRLFVKLPELL    ++E++L  L   L D L+FL K
Sbjct: 121 LKDNLLSAESDKRPSDIYGAEHLLRLFVKLPELLSQTNMDEQSLNRLLKHLEDFLRFLAK 180

Query: 307 HQSTFFLS 314
           +   +F+ 
Sbjct: 181 NAEEYFVK 188

This family consists of three different eukaryotic proteins (mortality factor 4 (MORF4/MRG15), male-specific lethal 3(MSL-3) and ESA1-associated factor 3(EAF3)). It is thought that the MRG family is involved in transcriptional regulation via histone acetylation. It contains 2 chromo domains and a leucine zipper motif. Length = 191
>gnl|CDD|152153 pfam11717, Tudor-knot, RNA binding activity-knot of a chromodomain Back     alignment and domain information
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
PF05712194 MRG: MRG; InterPro: IPR008676 This family consists 100.0
KOG3001391 consensus Dosage compensation regulatory complex/h 100.0
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 99.82
PLN00104 450 MYST -like histone acetyltransferase; Provisional 99.56
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 97.72
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.58
cd0002455 CHROMO Chromatin organization modifier (chromo) do 97.27
smart0029855 CHROMO Chromatin organization modifier domain. 97.18
smart0074361 Agenet Tudor-like domain present in plant sequence 97.15
PTZ00064 552 histone acetyltransferase; Provisional 96.93
COG5027 395 SAS2 Histone acetyltransferase (MYST family) [Chro 96.7
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 96.58
PF06003264 SMN: Survival motor neuron protein (SMN); InterPro 96.15
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 96.14
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 96.1
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 95.97
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 95.5
cd0583483 HDGF_related The PWWP domain is an essential part 94.91
cd05837110 MSH6_like The PWWP domain is present in MSH6, a mi 94.89
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 94.73
PLN03239 351 histone acetyltransferase; Provisional 94.47
smart0029363 PWWP domain with conserved PWWP motif. conservatio 94.1
KOG2748369 consensus Uncharacterized conserved protein, conta 93.08
PF0282073 MBT: mbt repeat; InterPro: IPR004092 The function 92.46
PF07039130 DUF1325: SGF29 tudor-like domain; InterPro: IPR010 90.57
cd0584093 SPBC215_ISWI_like The PWWP domain is a component o 89.24
PF15057124 DUF4537: Domain of unknown function (DUF4537) 88.94
cd0583587 Dnmt3b_related The PWWP domain is an essential com 87.44
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 84.28
cd0583895 WHSC1_related The PWWP domain was first identified 81.4
>PF05712 MRG: MRG; InterPro: IPR008676 This family consists of three different eukaryotic proteins (mortality factor 4 (MORF4/MRG15), male-specific lethal 3(MSL-3) and ESA1-associated factor 3(EAF3)) Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=340.21  Aligned_cols=157  Identities=48%  Similarity=0.760  Sum_probs=127.2

Q ss_pred             cCCCceeEEeCChhHHHHHHHHhHhhhhCCceecCCCCCCHHHHHHHHHHhhhccCCc--h-----hhhHHHHHHHHHHH
Q 020039          160 LQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGL--V-----ADSTGEIVKGLRCY  232 (332)
Q Consensus       160 ~~~~~~i~I~iP~~Lk~iLvdD~e~Itk~~kL~~LPa~~tV~~IL~~Y~~~~~~~~~~--~-----~~~~~E~~~Gl~~Y  232 (332)
                      ....+++.|+||..||.+|||||++|+++++|++|||++||++||++|+++.......  .     ...++|+++||++|
T Consensus        18 ~~~~~~~~i~lP~~Lk~~LvdD~~~I~~~~~l~~LP~~~~V~~IL~~y~~~~~~~~~~~~~~~~~~~~~~~e~~~Gl~~y   97 (194)
T PF05712_consen   18 SEEEPEIKIELPEELKKILVDDWELITKEKKLVKLPAKPSVDDILEDYVESFADSDDSEEESAEQERDLLKEVADGLRDY   97 (194)
T ss_dssp             ------------HHHHHHHHHHHHHHHTS-EEE-SS-SSBHHHHHHHHHHHHHHCHCSS---THH--HHHHHHHHHHHHH
T ss_pred             cccCceEEEECCHHHHHHHHHHHHHHHcCCceeeCCCCCCHHHHHHHHHHHHhhcccCcchhHHHHHHHHHHHHHHHHHH
Confidence            3555789999999999999999999999999999999999999999999999743211  1     14689999999999


Q ss_pred             HhhhcCcccCChhhHhhHHHhhhcC------------CCCCcccchHHHHHHHhhhhHhhhcCCCCHHHHHHHHHHHHHH
Q 020039          233 FDKALPIMLLYKSEREQYEDSMAAD------------VSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDL  300 (332)
Q Consensus       233 Fn~~L~~~LLY~~ER~QY~~ll~~~------------~~pS~iYG~~HLLRLfvkLP~lL~~t~~d~~s~~~l~~~l~~f  300 (332)
                      ||++||++|||++||.||.+++...            .+||++||++|||||||+||+||+.++|++.+++.|+.++++|
T Consensus        98 Fn~~L~~~LLY~~Er~Qy~~~~~~~~~~~~~~~~~~~~~ps~~YG~~HLLRL~vkLPell~~~~~~~~~~~~l~~~l~~f  177 (194)
T PF05712_consen   98 FNKALGSQLLYKFERPQYDELLKKHATRDDSPPDEPGFRPSDIYGAIHLLRLFVKLPELLSSTNMDEESINILLEHLQDF  177 (194)
T ss_dssp             HHHHCCCCTS-GGGHHHHHHHHHHS---------STTS-HHHC-BHHHHHHHHHHHHHHHCCCGGCHHHHHHHHHHHHHH
T ss_pred             HHHHhccccCcHHHHHHHHHHHHhcccchhccccCCCCCHHhhccHHHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHH
Confidence            9999999999999999999998653            5999999999999999999999999999999999999999999


Q ss_pred             HHHHHHchhcccc-ccC
Q 020039          301 LKFLQKHQSTFFL-SRY  316 (332)
Q Consensus       301 L~fL~~n~~~~F~-~dY  316 (332)
                      |+||++|.+.||. ++|
T Consensus       178 l~fL~~n~~~~f~~~~y  194 (194)
T PF05712_consen  178 LKFLEKNSEEYFSEEDY  194 (194)
T ss_dssp             HHHHHHTHHHHS-GGGE
T ss_pred             HHHHHHHHHHhCCcccC
Confidence            9999999999999 666

It is thought that the MRG family is involved in transcriptional regulation via histone acetylation [, ].; GO: 0005634 nucleus; PDB: 2AQL_A 2F5J_A 2LKM_B 2Y0N_D.
>KOG3001 consensus Dosage compensation regulatory complex/histone acetyltransferase complex, subunit MSL-3/MRG15/EAF3, and related CHROMO domain-containing proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression Back     alignment and domain information
>PF07039 DUF1325: SGF29 tudor-like domain; InterPro: IPR010750 SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes Back     alignment and domain information
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
2lkm_B172 Structural Basis For Molecular Interactions Involvi 1e-25
2aql_A173 Crystal Structure Of The Mrg15 Mrg Domain Length = 4e-25
2f5j_A181 Crystal Structure Of Mrg Domain From Human Mrg15 Le 5e-25
2y0n_A211 Crystal Structure Of The Complex Between Dosage Com 1e-20
2efi_A100 Solution Structure Of The Chromo Domain Of Mortalit 4e-09
2f5k_A102 Crystal Structure Of The Chromo Domain Of Human Mrg 5e-09
2lrq_A85 Chemical Shift Assignment And Solution Structure Of 8e-07
3ob9_A97 Structure Of The Human Msl3 Chromo-Barrel Domain At 4e-04
3oa6_A110 Human Msl3 Chromodomain Bound To Dna And H4k20me1 P 4e-04
2k3y_A136 Solution Structure Of Eaf3 Chromo Barrel Domain Bou 9e-04
>pdb|2LKM|B Chain B, Structural Basis For Molecular Interactions Involving Mrg Domains: Implications In Chromatin Biology Length = 172 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 94/164 (57%), Gaps = 9/164 (5%)
Query: 166 VNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVAD--STG 223
           V ++IP  LK  LVDD + IT   +L  LP   NVD ILE Y +YR  +        +  
Sbjct: 5   VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYRKSRGNTDNKEYAVN 64
Query: 224 EIVKGLRCYFDKALPIMLLYKSEREQYEDSMA--ADVSPSSVYGAEHLLRLFVKLPELLV 281
           E+V G++ YF+  L   LLYK ER QY + +A   D   S VYGA HLLRLFV++  +L 
Sbjct: 65  EVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLA 124
Query: 282 HAKIEEETLTLLQHKLVDLLKFLQKHQSTFFLSRYHSAEDVETS 325
           +  ++E++L LL + L D LK+L K+ +T F     SA D E +
Sbjct: 125 YTPLDEKSLALLLNYLHDFLKYLAKNSATLF-----SASDYEVA 163
>pdb|2AQL|A Chain A, Crystal Structure Of The Mrg15 Mrg Domain Length = 173 Back     alignment and structure
>pdb|2F5J|A Chain A, Crystal Structure Of Mrg Domain From Human Mrg15 Length = 181 Back     alignment and structure
>pdb|2Y0N|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Msl3 Length = 211 Back     alignment and structure
>pdb|2EFI|A Chain A, Solution Structure Of The Chromo Domain Of Mortality Factor 4-Like Protein 1 From Human Length = 100 Back     alignment and structure
>pdb|2F5K|A Chain A, Crystal Structure Of The Chromo Domain Of Human Mrg15 Length = 102 Back     alignment and structure
>pdb|2LRQ|A Chain A, Chemical Shift Assignment And Solution Structure Of Fr822a From Drosophila Melanogaster. Northeast Structural Genomics Consortium Target Fr822a Length = 85 Back     alignment and structure
>pdb|3OB9|A Chain A, Structure Of The Human Msl3 Chromo-Barrel Domain At 2.5 Angstrom Resolution Length = 97 Back     alignment and structure
>pdb|3OA6|A Chain A, Human Msl3 Chromodomain Bound To Dna And H4k20me1 Peptide Length = 110 Back     alignment and structure
>pdb|2K3Y|A Chain A, Solution Structure Of Eaf3 Chromo Barrel Domain Bound To Histone H3 With A Dimethyllysine Analog H3k36me2 Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
2f5j_A181 Mortality factor 4-like protein 1; MRG fold, mainl 2e-51
2y0n_A211 MALE-specific lethal 3 homolog; transcription, chr 8e-44
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 4e-18
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 7e-18
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 3e-17
2lcc_A76 AT-rich interactive domain-containing protein 4A; 5e-17
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 2e-13
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 7e-12
2k3y_A136 Chromatin modification-related protein EAF3; dimet 1e-10
3e9g_A130 Chromatin modification-related protein EAF3; chrom 2e-09
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 2e-09
2bud_A92 Males-absent on the first protein; transferase, MO 2e-08
3sd4_A69 PHD finger protein 20; tudor domain, transcription 7e-08
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 3e-07
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 1e-05
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 3e-05
>2f5j_A Mortality factor 4-like protein 1; MRG fold, mainly A-helix, gene regulation; 2.20A {Homo sapiens} PDB: 2aql_A 2lkm_B Length = 181 Back     alignment and structure
 Score =  167 bits (424), Expect = 2e-51
 Identities = 66/159 (41%), Positives = 92/159 (57%), Gaps = 5/159 (3%)

Query: 166 VNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVA--DSTG 223
           V ++IP  LK  LVDD + IT   +L  LP   NVD ILE Y +Y+  +        +  
Sbjct: 6   VKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVN 65

Query: 224 EIVKGLRCYFDKALPIMLLYKSEREQYEDSMA--ADVSPSSVYGAEHLLRLFVKLPELLV 281
           E+V G++ YF+  L   LLYK ER QY + +A   D   S VYGA HLLRLFV++  +L 
Sbjct: 66  EVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLA 125

Query: 282 HAKIEEETLTLLQHKLVDLLKFLQKHQSTFF-LSRYHSA 319
           +  ++E++L LL + L D LK+L K+ +T F  S Y  A
Sbjct: 126 YTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVA 164
>2y0n_A MALE-specific lethal 3 homolog; transcription, chromatin, X chromosome, MSL complex; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Length = 85 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Length = 102 Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} Length = 101 Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Length = 133 Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Length = 136 Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Length = 130 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Length = 88 Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Length = 92 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Length = 69 Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 94 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
2f5j_A181 Mortality factor 4-like protein 1; MRG fold, mainl 100.0
2y0n_A211 MALE-specific lethal 3 homolog; transcription, chr 100.0
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 99.96
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 99.95
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 99.95
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 99.94
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 99.89
3e9g_A130 Chromatin modification-related protein EAF3; chrom 99.93
2k3y_A136 Chromatin modification-related protein EAF3; dimet 99.93
2lcc_A76 AT-rich interactive domain-containing protein 4A; 99.87
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 99.84
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 99.81
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 99.8
2bud_A92 Males-absent on the first protein; transferase, MO 99.79
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 99.78
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 99.42
3sd4_A69 PHD finger protein 20; tudor domain, transcription 99.25
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 98.59
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 97.9
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 97.56
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 97.55
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 97.52
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 97.39
3s6w_A54 Tudor domain-containing protein 3; methylated argi 97.31
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 97.29
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 97.24
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 97.23
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 97.21
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 97.16
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 97.12
3qii_A85 PHD finger protein 20; tudor domain, structural ge 96.85
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 96.84
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 96.77
2eqj_A66 Metal-response element-binding transcription facto 96.57
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 96.53
2d9t_A78 Tudor domain-containing protein 3; structural geno 96.51
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 96.31
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 95.14
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 96.13
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 95.92
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 95.76
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 95.62
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 95.53
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 95.41
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 95.33
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 95.23
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 95.13
1pfb_A55 Polycomb protein; chromatin, histone methylation, 95.09
3h91_A54 Chromobox protein homolog 2; human chromobox homol 95.04
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 95.04
2l89_A108 PWWP domain-containing protein 1; histone binding, 94.94
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 94.87
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 94.83
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 94.82
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 94.66
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 94.65
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 94.65
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 94.49
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 94.47
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 94.45
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 94.44
2kvm_A74 Chromobox protein homolog 7; histone modification, 94.41
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 94.2
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 94.08
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 94.06
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 93.84
2diq_A110 Tudor and KH domain-containing protein; tudor doma 93.69
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 93.54
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 93.38
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 93.24
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 93.23
3pfs_A158 Bromodomain and PHD finger-containing protein 3; s 93.15
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 92.66
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 92.48
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 91.9
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 91.88
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 91.59
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 90.01
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 89.78
3qby_A94 Hepatoma-derived growth factor-related protein 2; 89.57
2qqr_A118 JMJC domain-containing histone demethylation prote 89.45
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 89.23
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 89.0
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 88.01
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 87.65
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 87.58
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 86.97
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 86.7
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 86.49
3mea_A180 SAGA-associated factor 29 homolog; structural geno 85.74
3bdl_A570 Staphylococcal nuclease domain-containing protein 85.51
3mp6_A522 MBP, SGF29, maltose-binding periplasmic protein, l 85.15
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 84.31
2xdp_A123 Lysine-specific demethylase 4C; oxidoreductase, hi 83.22
3l42_A130 Peregrin; transcription regulation, histone H3 ace 82.46
>2f5j_A Mortality factor 4-like protein 1; MRG fold, mainly A-helix, gene regulation; 2.20A {Homo sapiens} PDB: 2aql_A 2lkm_B Back     alignment and structure
Probab=100.00  E-value=2.4e-52  Score=372.72  Aligned_cols=168  Identities=40%  Similarity=0.610  Sum_probs=148.9

Q ss_pred             CceeEEeCChhHHHHHHHHhHhhhhCCceecCCCCCCHHHHHHHHHHhhhccCC--chhhhHHHHHHHHHHHHhhhcCcc
Q 020039          163 ENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDG--LVADSTGEIVKGLRCYFDKALPIM  240 (332)
Q Consensus       163 ~~~i~I~iP~~Lk~iLvdD~e~Itk~~kL~~LPa~~tV~~IL~~Y~~~~~~~~~--~~~~~~~E~~~Gl~~YFn~~L~~~  240 (332)
                      +++++|.||+.||.+|||||++|+++++|++|||++||++||++|+++......  ....++.|+++||+.|||++||.+
T Consensus         3 ~~~i~i~iP~~Lk~~LvdDw~~Itk~~~L~~LP~~~~V~~IL~~Y~~~~~~~~~~~~~~~~~~Ev~~Gl~~YFd~~L~~~   82 (181)
T 2f5j_A            3 RVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQ   82 (181)
T ss_dssp             ---CCCCCCGGGHHHHHHHHHHHHTSCEEECSSCSSBHHHHHHHHHHHHHC--------CHHHHHHHHHHHHHHHHHHHH
T ss_pred             CceEEEeCCHHHHHHHHHHHHHHHhCCCeeeCCCCCcHHHHHHHHHHhhcccCCchhHHHHHHHHHHHHHHHHHHHcccc
Confidence            456899999999999999999999999999999999999999999999876542  223578999999999999999999


Q ss_pred             cCChhhHhhHHHhhhc--CCCCCcccchHHHHHHHhhhhHhhhcCCCCHHHHHHHHHHHHHHHHHHHHchhcccc-ccCC
Q 020039          241 LLYKSEREQYEDSMAA--DVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLKFLQKHQSTFFL-SRYH  317 (332)
Q Consensus       241 LLY~~ER~QY~~ll~~--~~~pS~iYG~~HLLRLfvkLP~lL~~t~~d~~s~~~l~~~l~~fL~fL~~n~~~~F~-~dY~  317 (332)
                      |||++||+||.++++.  +.+||++||++|||||||+||+||+.++||+++++.|+.++++||+||++|.++||. ++|+
T Consensus        83 LLY~~ER~Qy~~ll~~~p~~~~S~iYGa~HLLRLfvkLPell~~t~~d~~s~~~L~~~l~~fl~fL~~n~~~~F~~~~Y~  162 (181)
T 2f5j_A           83 LLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYE  162 (181)
T ss_dssp             SCCGGGHHHHHHHHHHSTTCCHHHHCBHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHHHHHHHTHHHHCCGGGEE
T ss_pred             cCcHHHHHHHHHHHHhCCCCCHHHHcCHHHHHHHHHHhHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCHHhcC
Confidence            9999999999999863  568999999999999999999999999999999999999999999999999999995 9999


Q ss_pred             CCCHHHHHhhccc
Q 020039          318 SAEDVETSANKQE  330 (332)
Q Consensus       318 ~as~eY~~~a~~~  330 (332)
                      +++|+|+++|...
T Consensus       163 ~~~~eY~~~~~~~  175 (181)
T 2f5j_A          163 VAPPEYHRKAVLE  175 (181)
T ss_dssp             ECCHHHHC-----
T ss_pred             CCCHHHHHHHhhh
Confidence            9999999999764
>2y0n_A MALE-specific lethal 3 homolog; transcription, chromatin, X chromosome, MSL complex; 3.00A {Homo sapiens} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3mea_A SAGA-associated factor 29 homolog; structural genomics consortium, SGC, nucleus, transcription, transcription regulation, chromosomal protein, DNA-binding; HET: M3L; 1.26A {Homo sapiens} PDB: 3meu_A* 3met_A* 3me9_A* 3mev_A* 3lx7_A 3mew_A Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} Back     alignment and structure
>3l42_A Peregrin; transcription regulation, histone H3 acetylation, chromatin modification, structural genomics, structural genomics CONS SGC, activator; 1.30A {Homo sapiens} PDB: 3mo8_A* 2x4w_A* 2x35_A* 2x4x_A* 2x4y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d2f5ka183 b.34.13.3 (A:6-88) Mortality factor 4-like protein 2e-18
d1wgsa_133 b.34.13.3 (A:) Probable histone acetyltransferase 9e-14
d2buda188 b.34.13.3 (A:367-454) Putative histone acetyltrans 3e-11
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo barrel domain
domain: Mortality factor 4-like protein 1, MRG15
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.9 bits (189), Expect = 2e-18
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 10/88 (11%)

Query: 51  PYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEAN 110
            +Q  E+VL F    +YEAK ++V  + K+  + +HY GWNK+WDEWV   R++K  + N
Sbjct: 5   KFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTN 64

Query: 111 RHRQPVFTKKRDEDKNLKSGHALQMKPR 138
             +Q          + L+  +  Q    
Sbjct: 65  LQKQ----------RELQKANQEQYAEG 82
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 99.96
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 99.78
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 99.68
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 97.25
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 97.03
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.92
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 96.92
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 96.91
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 96.79
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 96.78
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 96.7
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 96.58
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 96.46
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 96.26
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 95.86
d2diga155 Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 95.77
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 94.64
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 94.59
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 94.0
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 93.99
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 93.89
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 92.52
d1wjra_127 Scm-like with four MBT domains protein 2, SFMBT2 ( 91.54
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 88.58
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 87.79
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 86.83
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 86.75
d2qqra159 Jumonji domain-containing protein 2A {Human (Homo 86.47
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo barrel domain
domain: Mortality factor 4-like protein 1, MRG15
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.9e-30  Score=201.49  Aligned_cols=75  Identities=36%  Similarity=0.688  Sum_probs=70.7

Q ss_pred             CCCCcCCCCEEEEEeCCeeeeeEEEEEEeeCCeeEEEEEEcCCCCCccceeccccccccChHhhhhchhhhhhhh
Q 020039           48 ASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRD  122 (332)
Q Consensus        48 ~~~~f~vge~vl~~~~~~~YeAkIl~~~~~~~~~~Y~VHY~GWn~r~DEWV~~~ri~k~t~en~~~qk~L~~~~~  122 (332)
                      |...|++||+|||+||+.+|+|||++++..++.++|+|||+|||+||||||+++||+++|++|+++|++|.++++
T Consensus         2 p~~~f~~ge~Vlc~~~~~lYeAkil~~~~~~~~~~Y~VHy~GWn~~~DeWv~~~ril~~~~en~~~q~~L~~~~~   76 (83)
T d2f5ka1           2 PKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQ   76 (83)
T ss_dssp             CSCSCCTTCEEEEESSSSEEEEEEEEEEEETTEEEEEEEETTSCGGGCEEEEGGGEEESSHHHHHHHHHHHHHHH
T ss_pred             CCCccCCCCEEEEEECCeeEEeEEEEEEEcCCceEEEEEecccCCccccccChhhcccCCHHHHHHHHHHHHHHH
Confidence            344699999999999999999999999999999999999999999999999999999999999999999987664
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure