Citrus Sinensis ID: 020068

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-

MENHGSGFRRVLLLAFCVAGIWSAYIYQGILQETLSTKRFGPDGKRFQHLAFLNLAQNVVCLIWSYIMLKLWSSSAGGAPWWTYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGTLVYGIRYTLPEYICTLLVAGGVSSFALMKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTSAWDIMLGMNLWGTIYNLFYMFGWPHGSGFEAIQFCKQHPEAAWDIFFYCLCGAVGQNFIFLTISRFGSLTNTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVLMVFSGLSYQIYLKWRKLQRLQKKRKPM

ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

*******FRRVLLLAFCVAGIWSAYIYQGILQETLSTKRFGPDGKRFQHLAFLNLAQNVVCLIWSYIMLKLWSSSAGGAPWWTYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGTLVYGIRYTLPEYICTLLVAGGVSSFALMKTS********HPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTSAWDIMLGMNLWGTIYNLFYMFGWPHGSGFEAIQFCKQHPEAAWDIFFYCLCGAVGQNFIFLTISRFGSLTNTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVLMVFSGLSYQIYLKWR************

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-galactose/UDP-glucose transporter 3	Essential sugar transporter required for the transport of UDP-glucose from the cytoplasm into the Golgi and the endoplasmic reticulum. Essential for pollen development and involved in embryo sac progress.	confident	Q9M9S6
Solute carrier family 35 member B1	Probable sugar transporter.	probable	Q8AXS6
Solute carrier family 35 member B1	Probable sugar transporter.	probable	Q8AWB6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 84-155
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 252-316
View the alignment between query and template
View the model in PyMOL