Citrus Sinensis ID: 020097


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MMMYESLPHHYQYQEINRITLAHFAISGLCLLGALDRVDKDAVSDWVLSLQAHPSNKADLTNGEFYGFHGSPSSQLHPDDNGVLMHNGSNLASTYCALAILKAVGYNFANIDSKSILTSMRNLQQHDGSFMPIHFGAEKDLRFVYCAAAICFLLEDWSGMDRERAKAYILNCQSYDGGFGLTPGSESHGGGTYCAVASLRLMGFIEDNVLSKNTSSSIIDLPLLLSWCLQRQAADGGFQGRANKPSDTCYAFWIGSVLRMLGGYNLIDKEALRGFLLTCQSQYGGFGKCPGDLPDLYHSFYGYTAFSLLEEPGLNPLCAELGMTEFSALGI
cccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccc
MMMYESLPHHYQYQEINRITLAHFAISGLCLLGALDRVDKDAVSDWVLSLQAHPSNKADLTNGEFYGFHGSPSSQLHPDDNGVLMHNGSNLASTYCALAILKAVGYNFANIDSKSILTSMRNLQQHDGSFMPIHFGAEKDLRFVYCAAAICFLLEDWSGMDRERAKAYILNCQSYDGGFGLTPGSESHGGGTYCAVASLRLMGFIEDNVLSKNTSSSIIDLPLLLSWCLQRQAADGGFQGRANKPSDTCYAFWIGSVLRMLGGYNLIDKEALRGFLLTCQSQYGGFGKCPGDLPDLYHSFYGYTAFSLLEEPGLNPLCAELGMTEFSALG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMYESLPHHYQYQEINRITLAHFAISGLCLLGALDRVDKDAVSDWVLSLQAHPSNKADLTNGEFYGFHGSPSSQLHPDDNGVLMHNGSNLASTYCALAILKAVGYNFANIDSKSILTSMRNLQQHDGSFMPIHFGAEKDLRFVYCAAAICFLLEDWSGMDRERAKAYILNCQSYDGGFGLTPGSESHGGGTYCAVASLRLMGFIEDNVLSKNTSSSIIDLPLLLSWCLQRQAADGGFQGRANKPSDTCYAFWIGSVLRMLGGYNLIDKEALRGFLLTCQSQYGGFGKCPGDLPDLYHSFYGYTAFSLLEEPGLNPLCAELGMTEFSALGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Geranylgeranyl transferase type-1 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.probableQ55DA3
Geranylgeranyl transferase type-1 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal C-A-A-L where A is an aliphatic amino acid. In particular it modifies the GTP-binding component of the 1,3-beta-D-glucan synthase.probableP32434

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.59Protein geranylgeranyltransferase type I.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DSS, chain B
Confidence level:very confident
Coverage over the Query: 2-71,88-206,218-327
View the alignment between query and template
View the model in PyMOL
Template: 1N4Q, chain B
Confidence level:very confident
Coverage over the Query: 1-327
View the alignment between query and template
View the model in PyMOL