Citrus Sinensis ID: 020113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVDEPSKYGVVVMEETTGKVEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGFWMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVNPEIVM
cEEEEEEcccccccccccccccccccEEccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccccccEEEEEccEEccccHHHHHHHHHHccccEEEEccccccccEEEEEccccEEEEEEEccccccccEEEEEEEEEcHHHHHcccccccccHHccHHHHHccccEEEEEcccEEECcccHHHHHHHHHHHHHHHccccccccccccEEcccEEEccccEEcccEEEcccccEEEEcEEEccccEEccccEEcccEEEccccEEccEEEEcccEEccccEEccccccccccc
MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVDEPSKYGVVVMEETTGKVEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGFWMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVNPEIVM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVDEPSKYGVVVMEETTGKVEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGFWMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADEVYSNGAVVLPHKEIKSSIVNPEIVM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable mannose-1-phosphate guanylyltransferase 2 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants.confidentQ941T9
Probable mannose-1-phosphate guanylyltransferase 3 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants.confidentQ6Z9A3
Mannose-1-phosphate guanylyltransferase 1 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. Plays an essential role in plant growth and development and cell-wall architecture. Provides GDP-mannose, used for cell wall carbohydrate biosynthesis, protein N-glycosylation, as well as for the biosynthesis of the antioxidant ascorbate.confidentO22287

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.13Mannose-1-phosphate guanylyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BRK, chain X
Confidence level:very confident
Coverage over the Query: 3-326
View the alignment between query and template
View the model in PyMOL