Citrus Sinensis ID: 020141


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MAAKSQIVTGFTMPMTPAPSSSSSSSSSSLCMVKKPLTTSFFNGGVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASQKRLENKCKAAEQASEDWYRKAQLALQKGEEDLAREALKRRKSYADNANALKAQLDQQKNVVNNLVSNTRLLESKIQEARSKKDTLKARAQSAKTATKVSEMLGNVNTSSALSAFEKMEEKVLTMESQADSLNQLTTDDLEGKFALLETSSVDDDLANLKKELSGSSKKGELPPGRAAASSTNTAFPFRDAEIEKELNELRQRAKDF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcc
*******************************MVKKPLTTSFFNGGVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLA******************WYRKAQLALQKGEEDLAREALKRRK**************************************************************************KMEEKVLTMES*************************************************************************RQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKSQIVTGFTMPMTPAPSSSSSSSSSSLCMVKKPLTTSFFNGGVTRLRIAPSSRSHCYRQGGGALNTRMNLFDRLARVVKSYANAILSSFEDPEKILEQAVLEMNDDLVKMRQATAQVLASxxxxxxxxxxxxxxxxxxxxxAQLALQKGEEDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTKVSEMLGNVNTSSALSAxxxxxxxxxxxxxxxxxxxxxTTDDLEGKFALLETSSVDDDLANLKKELSGSSKKGELPPGRAAASSTNTAFPFRDAEIEKELNELRQRAKDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable membrane-associated 30 kDa protein, chloroplastic confidentQ8S0J7
Membrane-associated protein VIPP1, chloroplastic Required for plastid vesicle formation and thylakoid membrane biogenesis, but not for functional assembly of thylakoid protein complexes.probableO80796
Membrane-associated 30 kDa protein, chloroplastic probableQ03943

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:confident
Coverage over the Query: 101-167
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 97-244
View the alignment between query and template
View the model in PyMOL
Template: 3MQ9, chain A
Confidence level:probable
Coverage over the Query: 73-209
View the alignment between query and template
View the model in PyMOL