Citrus Sinensis ID: 020152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MVALSTKPAIEQFPYIETCCTTSALFTSTSNSIPLIDLSNPDSKNLLVKACEEFGFFKVINHGVPLESISRLESEAIRFFSLPFSEKEKSGPPSPFGYGNKCIGRNGDVGWVEYLLLNTNQDSNSSLGNNPDQFRFALSEYISAVKRMACEILELMADGLKIQPRNVLSKLLMDEQSDSVFRLNHYPPRPDRISNLIGFGEHTDPQIISVLRSNNTSGLQISLREGSWISVPPDEDSFFINVGDSLQVLTNGRFKSVKHRVLANSLKSRVSMIYFGGPPLSERIAPLPSLMKNPEQSLYKEFTWFEYKRSAYNSRLAENRLMHFERIAAS
ccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccCEEEEcccccccccccccccccccccccccEEEEEcccccEEEEEccccEEEcccccccEEEEEccEEEEECcccccccccEEEEcccccEEEEEEEcccccccEECccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHcc
*******PAIEQFPYIETCCTTSALFTSTSNSIPLIDLSNPDSKNLLVKACEEFGFFKVINHGVPLESISRLESEAIRFFSLPFS**********FGYGNKCIGRNGDVGWVEYLLLNTNQDSNSSLGNNPDQFRFALSEYISAVKRMACEILELMADGLKIQPRNVLSKLLMDEQSDSVFRLNHYPPRPDRISNLIGFGEHTDPQIISVLRSNNTSGLQISLREGSWISVPPDEDSFFINVGDSLQVLTNGRFKSVKHRVLANSLKSRVSMIYFGGPPLSERIAPLPSLMKNPEQSLYKEFTWFEYKRSAYNSRLAENRLMHFERIA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVALSTKPAIEQFPYIETCCTTSALFTSTSNSIPLIDLSNPDSKNLLVKACEEFGFFKVINHGVPLESISRLESEAIRFFSLPFSEKEKSGPPSPFGYGNKCIGRNGDVGWVEYLLLNTNQDSNSSLGNNPDQFRFALSEYISAVKRMACEILELMADGLKIQPRNVLSKLLMDEQSDSVFRLNHYPPRPDRISNLIGFGEHTDPQIISVLRSNNTSGLQISLREGSWISVPPDEDSFFINVGDSLQVLTNGRFKSVKHRVLANSLKSRVSMIYFGGPPLSERIAPLPSLMKNPEQSLYKEFTWFEYKRSAYNSRLAENRLMHFERIAAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin 2-beta-dioxygenase 1 Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level. Catabolism of gibberellins (GAs) plays a central role in plant development. Converts GA9/GA20 to GA51/GA29 and GA4/GA1 to GA34/GA8.probableQ8LEA2
Gibberellin 2-beta-dioxygenase Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level. Catabolism of gibberellins (GAs) plays a central role in plant development. Converts GA9/GA20 to GA51/GA29 and GA4/GA1 to GA34/GA8.probableQ9XG83
Gibberellin 2-beta-dioxygenase 2 Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level. Catabolism of gibberellins (GAs) plays a central role in plant development. Converts GA9/GA20 to GA51/GA29 and GA4/GA1 to GA34/GA8.probableQ9XHM5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable
1.14.11.13Gibberellin 2-beta-dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 32-319
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 11-319
View the alignment between query and template
View the model in PyMOL