Citrus Sinensis ID: 020201

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MPSSPKFFYARSAASPSPRKSTVLIFSCLIIGIAGFVLGISAFLYAGRGAHRCSNFNPTSVRVVWDNHGEGSNGISGSQDDDNNNNNNIKRHKVMGFVGIQTGFGSGGRRRSLRMTWMPSDHQGLQQLEEATGLAFRFIIGRTNDQSKMAELRKEVAEYDDFILLDIEEEYSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERPHSQTYLGCMKKGPVFTDPHLKWYEPQSYLLGKEYFLHAYGPLYALSADVVVSLVALKNNSFRMFSNEDVTIGSWMLAMNVNHEDNRELCQSDCTSSFIAVWDIPKCSGWWLI

ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEcccccccccccccccccEEcccccccccccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHccccccccccHHHccccEEEEEEEEEcccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHccccCEEEEEccccEEcHHHHHHHHHHccccccEEEEEECcccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHccccEECccccccccccccEEEEECcccccccccc

*****************PRKSTVLIFSCLIIGIAGFVLGISAFLYAGRGAHRCSNFNPTSVRVVWDN**************************VMGFVGIQTGFGSGGRRRSLRMTWMPSDHQGLQQLEEATGLAFRFIIGRTNDQSKMAELRKEVAEYDDFILLDIEEEYSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERPHSQTYLGCMKKGPVFTDPHLKWYEPQSYLLGKEYFLHAYGPLYALSADVVVSLVALKNNSFRMFSNEDVTIGSWMLAMNVNHEDNRELCQSDCTSSFIAVWDIPKCSGWWLI

xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable beta-1,3-galactosyltransferase 14	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	probable	Q8L7M1
Probable beta-1,3-galactosyltransferase 13	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	probable	Q9LKA9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 93-123,135-227,251-307
View the alignment between query and template
View the model in PyMOL