Citrus Sinensis ID: 020259


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MADTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYAQLSFFASAMQFFM
ccccccccccHHHHHHHcccccccccccccHHHHHHHHHcccEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEECcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHccccccccccccccEECccccccccCEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccccccccc
******S*SRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYAQLSFFASAMQFFM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADTAPSRSRDLDKLLLRAGNLVGPTFEPGTELRDDLQEYARILVVGAGGLGCELLKDLALSGFKNLEVIDMDRIEVSNLNRQFLFRMEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKDISFYNDFNIIVLGLDSIEARSYINAVACSFLEYETDDKPREETIKPMVDGGTEGFKGHARVIIPGVTPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKSFDPDDPEHMQWVYSEAVKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIASGCSKTLSNYLTYAQLSFFASAMQFFM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEDD8-activating enzyme E1 catalytic subunit Catalytic subunit of the dimeric ECR1-AXR1 E1 enzyme. E1 activates NEDD8/RUB1 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-ECR1 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of RCE1.probableO65041
NEDD8-activating enzyme E1 catalytic subunit Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression.probableQ5R4A0
NEDD8-activating enzyme E1 catalytic subunit Catalytic subunit of the dimeric uba-3-ula-1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-uba-3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of ubc-12 (By similarity). Required for cytokinesis and mitotic spindle orientation.probableQ19360

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMM, chain A
Confidence level:very confident
Coverage over the Query: 7-150,164-227
View the alignment between query and template
View the model in PyMOL
Template: 1TT5, chain B
Confidence level:very confident
Coverage over the Query: 1-320
View the alignment between query and template
View the model in PyMOL