Citrus Sinensis ID: 020280

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MAKFSVGRLEEGEGPSGNSKRQRRAPHRHPQTNLRDGEEEEEETHHQEEDDESVDNGGNGEKADLDLAGPSRNGPFSVTVTDPEVFDCPICYESLTAPVFQCENGHIACSTCCSKIMNKCPSCCTPIGYNRCRAIEKVLESVKVTCRNSNYGCKVTMSYGKKHDHEKICPHVPCSCPIPDCNFVGSANHLYKHFSAKHKNSALHFLYNEVVEVTLNVKNRFIVLQEEGDGVLFILSSRSETLGHVISVSCIAPSCKGCLFYSIFAGPAGSTVRFQSFTKNIQNRVDNPPSTGFLLVPIESFGSSGDLKLELCIRRLDISLQHVSRVVV
ccEEEcccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccCCcccccccccccccccccccEEccccccccccccccccccccccccHHHHcEEEcEEEEcccccccccCEECccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEcEEEEEEEcccccEEEEEEcccEEEEEEEEEccccEEEEEEEEEccccccccEEEEEEcccccEEEEEEEEEEEccccccccccccEEEccccccccccEEEEEEEEEEEEEEEEHHcccc
*******************************************************************************VTDPEVFDCPICYESLTAPVFQCENGHIACSTCCSKIMNKCPSCCTPIGYNRCRAIEKVLESVKVTCRNSNYGCKVTMSYGKKHDHEKICPHVPCSCPIPDCNFVGSANHLYKHFSAKHKNSALHFLYNEVVEVTLNVKNRFIVLQEEGDGVLFILSSRSETLGHVISVSCIAPSCKGCLFYSIFAGPAGSTVRFQSFTKNIQNRVDNPPSTGFLLVPIESFGSSGDLKLELCIRRLDISLQHVSRVVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKFSVGRLEEGEGPSGNSKRQRRAPHRHPQTNLRDGEEEEEETHHQEEDDESVDNGGNGEKADLDLAGPSRNGPFSVTVTDPEVFDCPICYESLTAPVFQCENGHIACSTCCSKIMNKCPSCCTPIGYNRCRAIEKVLESVKVTCRNSNYGCKVTMSYGKKHDHEKICPHVPCSCPIPDCNFVGSANHLYKHFSAKHKNSALHFLYNEVVEVTLNVKNRFIVLQEEGDGVLFILSSRSETLGHVISVSCIAPSCKGCLFYSIFAGPAGSTVRFQSFTKNIQNRVDNPPSTGFLLVPIESFGSSGDLKLELCIRRLDISLQHVSRVVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase SINA-like 10 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.probableQ84K34

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A25, chain A
Confidence level:very confident
Coverage over the Query: 173-316
View the alignment between query and template
View the model in PyMOL
Template: 3HCS, chain A
Confidence level:very confident
Coverage over the Query: 83-210
View the alignment between query and template
View the model in PyMOL