Citrus Sinensis ID: 020294

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MMATTHVGFLSFGSFLPLPSRISFSKRRTFAMAALSDDPIREWILSEGKATHITKICPVGGGCINLASRYGTDAGSFFVKTNRSIGPSMFEGEALGLGAMYETRTIRAPRPFKVGALPTGGSYIIMEFIEFGSSRGNQSVFGKKLAEMHKAGKSSKGFGFDVDNTIGSTPQINKWTSNWIEFYAEHRLGYQLKLALDQYGDSTIYQRGHRLMKNLAPLFEGVNVEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHNEAEFGMSWCAGFGGSFYNSYFEVMPKQPGFEKRRDLYMLYHYLNHYNLFGSGYRSSALSIIDDYLRMLKV

ccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHccccccEEEEEECcccccccEEEEECcccEEEEEEcccccccHHHHHHHHHHHHHHcccccccccEEEcccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccEECcccccccCECcccccEEEEccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc

*****HVGFLSFGSFLPLPSRISFSKRRTFAMAALSDDPIREWILSEGKATHITKICPVGGGCINLASRYGTDAGSFFVKTNRSIGPSMFEGEALGLGAMYETRTIRAPRPFKVGALPTGGSYIIMEFIEFGSSRGNQSVFGKKLAEMHKAGKSSKGFGFDVDNTIGSTPQINKWTSNWIEFYAEHRLGYQLKLALDQYGDSTIYQRGHRLMKNLAPLFEGVNVEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHNEAEFGMSWCAGFGGSFYNSYFEVMPKQPGFEKRRDLYMLYHYLNHYNLFGSGYRSSALSIIDDYLRMLKV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein-ribulosamine 3-kinase, chloroplastic	Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.	confident	Q10SM2
Protein-ribulosamine 3-kinase, chloroplastic	Initiates a process leading to the deglycation of proteins. Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions.	confident	Q9LEW8
Protein-ribulosamine 3-kinase, chloroplastic	Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.	probable	A2XBT1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JR1, chain A
Confidence level:very confident
Coverage over the Query: 37-325
View the alignment between query and template
View the model in PyMOL