Citrus Sinensis ID: 020296

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MATTFFRRLVKATPIAFNEAFGGQPKSDFNKFRFPFGAIAAVAGGVSYYCYFSSPNLVHLDQINEETDPKIALNPDKWIGFKLQDTARVSHNSHLFRFSFDPSAKLGLDVASCILTRAPLGQDAEGNTKYVVRPYTPISDTEAKGHFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYGNISPDDILLKQKLDILAASHPNLKVFYTVDNPTKNWKGGVGYISKDTALKGLPSPSDDALILVCGPPGMMKHVSGEKAKDYSQGELSGILKDLGYTEQMVYKF
cHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccCEEEEEEEEEEEcccCEEEEEEcccccccccccccEEEEEEccccccccccEEEEcccccccccccccEEEEEEECcccccccccccccccccEEEEEccccEEEEccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHccccccccccEEEECcccHHHHHHHccccccccccHHHHHHHHcccccccEEEc
***TFFRRLVKATPIAFNEAFGGQPKSDFNKFRFPFGAIAAVAGGVSYYCYFSSPNLVHLDQINEETDPKIALNPDKWIGFKLQDTARVSHNSHLFRFSFDPSAKLGLDVASCILTRAPLGQDAEGNTKYVVRPYTPISDTEAKGHFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYGNISPDDILLKQKLDILAASHPNLKVFYTVDNPTKNWKGGVGYISKDTALKGLPSPSDDALILVCGPPGMMKHVSGEKAKDYSQGELSGILKDLGYTEQMVYKF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTFFRRLVKATPIAFNEAFGGQPKSDFNKFRFPFGAIAAVAGGVSYYCYFSSPNLVHLDQINEETDPKIALNPDKWIGFKLQDTARVSHNSHLFRFSFDPSAKLGLDVASCILTRAPLGQDAEGNTKYVVRPYTPISDTEAKGHFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYGNISPDDILLKQKLDILAASHPNLKVFYTVDNPTKNWKGGVGYISKDTALKGLPSPSDDALILVCGPPGMMKHVSGEKAKDYSQGELSGILKDLGYTEQMVYKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-cytochrome b5 reductase-like protein Desaturation and elongation of fatty acids.confidentP83291
NADH-cytochrome b5 reductase 2 May mediate the reduction of outer membrane cytochrome b5.probableA2Q898
NADH-cytochrome b5 reductase 2 The outer membrane form may mediate the reduction of outer membrane cytochrome b5, and the soluble inter-membrane space form may transfer electrons from external NADH to cytochrome c, thereby mediating an antimycin-insensitive, energy-coupled oxidation of external NADH by yeast mitochondria. Involved in the reduction of D-erythroascorbyl free radicals.probableP36060

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.2.-With a heme protein as acceptor.probable
1.6.2.2Cytochrome-b5 reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMK, chain A
Confidence level:very confident
Coverage over the Query: 67-299,313-328
View the alignment between query and template
View the model in PyMOL