Citrus Sinensis ID: 020333


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
ccccccccEEEccHHHHHHHHcccccccEEEEEccccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHcccccccEEccccccccccEEEccccccccccccccEEEEccccccccc
ccccHHccEEEccHHcHHcHHHccccccEEEEEEEccccccccccccccccccEEEcccEEEccccccccccHHHHHccccEEEEccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHccccccccHHHHcccccccccccccccEEEHHHHHHHHHcccccccccccccccHHHHHcccccccccccccccccEEEEccHHHHHHHHccccccEEEccccccEEcEEEEcccEcccccEEEEEEEEccccccEEcc
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEwrssltipskeikkvyaggsgdggsgsvddlgdgsrsclsptkLLYSLEYAgkdlklvrmtvpirdmesenlLDYLDVCFDFIDRrrkeggvlvhcfagvSRSAAIITAYLMRTEQLSSEGALESLRQSCdsynrgekidsskfgadpglpvevlsgveaipnggdnrtpayrckkcRRVVALQENvvdhipgegetAFEWHKrksgnrfnrsdesecssifvePLRWMTAVEEGALEGKLSCAHCEarlgyfnwsgiqcscgswitpafqlhksrvdkstv
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPirdmesenllDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKidsskfgadpgLPVEVLSGveaipnggdnrtpayrCKKCRRVVALQenvvdhipgegetafewhkrksgnrfnrsdesecssIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAfqlhksrvdkstv
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAggsgdggsgsvddlgdgsRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
**YLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVY*********************CLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRT*************************************VEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWH***************CSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQL**********
**YLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQEN******************************ECSSIFVEPLRWMT*****ALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSG***********SSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLH*********
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGV*******DNRTPAYRCKKCRRVVALQENVVD**************************SECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSCDSYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSRVDKSTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q9UNI6340 Dual specificity protein yes no 0.691 0.664 0.380 4e-43
Q9JIM4339 Dual specificity protein yes no 0.681 0.657 0.361 6e-42
Q9D0T2339 Dual specificity protein yes no 0.681 0.657 0.357 3e-39
Q02256364 Tyrosine-protein phosphat yes no 0.669 0.601 0.296 2e-26
O13632330 Tyrosine-protein phosphat yes no 0.614 0.609 0.309 4e-26
Q54T76394 Probable dual specificity yes no 0.388 0.322 0.342 2e-20
Q8K4T5220 Dual specificity protein no no 0.333 0.495 0.352 7e-11
Q8WTR2217 Dual specificity protein no no 0.211 0.317 0.442 4e-10
Q9ZR37198 Dual specificity protein no no 0.217 0.358 0.444 5e-10
Q39491276 Dual specificity protein N/A no 0.226 0.268 0.386 8e-10
>sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 Back     alignment and function desciption
 Score =  175 bits (444), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 136/255 (53%), Gaps = 29/255 (11%)

Query: 102 LVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRTE 160
           L R+ VP  D    +LL +LD C  FI + R EG  VLVHC AGVSRS AIITA+LM+T+
Sbjct: 75  LWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTD 134

Query: 161 QLSSEGALESLR--------------QSCDSYNRGEKIDSS--------------KFGAD 192
           QL  E A E L+              Q       G ++D+S              K+   
Sbjct: 135 QLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPEL 194

Query: 193 PGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSG 252
             LP E+ +      + G      Y+C+KCRR +    +++DH  G G  AF   +    
Sbjct: 195 QNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPS 254

Query: 253 NRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWIT 312
           +      +++C+S F+EP++WM +   G ++G+L C  C A+LG FNW G QCSCG WIT
Sbjct: 255 SMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWIT 314

Query: 313 PAFQLHKSRVDKSTV 327
           PAFQ+HK+RVD+  +
Sbjct: 315 PAFQIHKNRVDEMKI 329





Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 Back     alignment and function description
>sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 Back     alignment and function description
>sp|Q02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVH1 PE=1 SV=1 Back     alignment and function description
>sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 Back     alignment and function description
>sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 Back     alignment and function description
>sp|Q8K4T5|DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus GN=Dusp19 PE=2 SV=1 Back     alignment and function description
>sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function description
>sp|Q39491|PTP3_CHLMO Dual specificity protein phosphatase OS=Chlamydomonas moewusii GN=VH-PTP13 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
255562308364 Dual specificity protein phosphatase, pu 0.993 0.892 0.724 1e-148
225440081366 PREDICTED: dual specificity protein phos 0.996 0.890 0.722 1e-144
224137682355 predicted protein [Populus trichocarpa] 0.966 0.890 0.707 1e-137
224089979352 predicted protein [Populus trichocarpa] 0.957 0.889 0.696 1e-135
449446728365 PREDICTED: dual specificity protein phos 0.993 0.890 0.692 1e-130
449489501365 PREDICTED: dual specificity protein phos 0.993 0.890 0.692 1e-130
87241169360 Dual specificity protein phosphatase [Me 0.966 0.877 0.633 1e-127
357509359370 Dual specificity protein phosphatase [Me 0.966 0.854 0.616 1e-126
356571921354 PREDICTED: dual specificity protein phos 0.960 0.887 0.634 1e-125
356504682354 PREDICTED: dual specificity protein phos 0.960 0.887 0.621 1e-125
>gi|255562308|ref|XP_002522161.1| Dual specificity protein phosphatase, putative [Ricinus communis] gi|223538599|gb|EEF40202.1| Dual specificity protein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 265/366 (72%), Positives = 289/366 (78%), Gaps = 41/366 (11%)

Query: 1   MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKV 60
           MPYLVR++LFIGNI DAA++LQ  S+EITH+LSVL+S SISFF EWR+ L IP+KEIKKV
Sbjct: 1   MPYLVRKNLFIGNIGDAAEVLQKDSTEITHILSVLNSPSISFFAEWRTGLNIPAKEIKKV 60

Query: 61  YAGGSGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDY 120
           Y GG  +  S S +DLG GS+S LSP KLLYSLEYAGKDLKLVRM VPIRDMESE+LLDY
Sbjct: 61  YVGGFDE--SASKEDLGTGSKSSLSPNKLLYSLEYAGKDLKLVRMAVPIRDMESEDLLDY 118

Query: 121 LDVCFDFIDRRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQSC----- 175
           LDVC DFID+ RKEG VLVHCFAGVSRSAAIITAYLMRTEQLS E ALESLR+SC     
Sbjct: 119 LDVCLDFIDQSRKEGSVLVHCFAGVSRSAAIITAYLMRTEQLSQEDALESLRESCEFVCP 178

Query: 176 ----------------------------------DSYNRGEKIDSSKFGADPGLPVEVLS 201
                                             DSYNRGEKIDSSKFGADPG+   V S
Sbjct: 179 NDGFLDQLKMFEDMGFKVDRASSIYKRFRLKVLGDSYNRGEKIDSSKFGADPGMSTGVSS 238

Query: 202 GVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHIPGEGETAFEWHKRKSGNRFNRSDES 261
            VEA PNG + RTPAYRCKKCRRVVALQENVVDHIPGEGET+F W+KRKSGN F++SDE 
Sbjct: 239 EVEASPNGENKRTPAYRCKKCRRVVALQENVVDHIPGEGETSFAWNKRKSGNPFDKSDEP 298

Query: 262 ECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSR 321
           ECSSIFVEPL+WM + EEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSR
Sbjct: 299 ECSSIFVEPLKWMASAEEGALEGKLSCAHCEARLGYFNWSGIQCSCGSWITPAFQLHKSR 358

Query: 322 VDKSTV 327
           VD S +
Sbjct: 359 VDISII 364




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440081|ref|XP_002282532.1| PREDICTED: dual specificity protein phosphatase 12 [Vitis vinifera] gi|297741650|emb|CBI32782.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224137682|ref|XP_002322618.1| predicted protein [Populus trichocarpa] gi|222867248|gb|EEF04379.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224089979|ref|XP_002308890.1| predicted protein [Populus trichocarpa] gi|222854866|gb|EEE92413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449446728|ref|XP_004141123.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489501|ref|XP_004158331.1| PREDICTED: dual specificity protein phosphatase 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|87241169|gb|ABD33027.1| Dual specificity protein phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357509359|ref|XP_003624968.1| Dual specificity protein phosphatase [Medicago truncatula] gi|355499983|gb|AES81186.1| Dual specificity protein phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356571921|ref|XP_003554119.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] Back     alignment and taxonomy information
>gi|356504682|ref|XP_003521124.1| PREDICTED: dual specificity protein phosphatase 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
UNIPROTKB|Q2RAU9356 Os11g0136800 "Os11g0136800 pro 0.452 0.415 0.64 1.5e-91
UNIPROTKB|Q2QY35356 LOC_Os12g03990 "Os12g0133700 p 0.452 0.415 0.633 2.4e-91
ZFIN|ZDB-GENE-050626-91305 dusp12 "dual specificity phosp 0.428 0.459 0.406 5.1e-45
UNIPROTKB|Q9UNI6340 DUSP12 "Dual specificity prote 0.446 0.429 0.389 4.7e-44
UNIPROTKB|F1S1C7340 LOC100626531 "Uncharacterized 0.434 0.417 0.408 9.6e-44
RGD|68375339 Dusp12 "dual specificity phosp 0.437 0.421 0.397 1.2e-43
UNIPROTKB|I3LL40327 I3LL40 "Uncharacterized protei 0.434 0.434 0.408 5.2e-43
UNIPROTKB|F1MW70345 DUSP12 "Uncharacterized protei 0.437 0.414 0.384 1.1e-42
MGI|MGI:1890614339 Dusp12 "dual specificity phosp 0.327 0.315 0.458 1.5e-41
UNIPROTKB|F1N842316 DUSP12 "Uncharacterized protei 0.425 0.439 0.425 2.8e-40
UNIPROTKB|Q2RAU9 Os11g0136800 "Os11g0136800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 516 (186.7 bits), Expect = 1.5e-91, Sum P(2) = 1.5e-91
 Identities = 96/150 (64%), Positives = 114/150 (76%)

Query:   177 SYNRGEKIDSSKFGADPGLPVEVLSGVEAIPNGGDNRTPAYRCKKCRRVVALQENVVDHI 236
             SY  GEKI S  F  DPGL  +  S  + +PN    +T AYRCKKCRR+VA+Q NVV H 
Sbjct:   208 SYKIGEKIGSYVFEDDPGLSGQPNSSTQDLPNKQTQQT-AYRCKKCRRIVAVQGNVVSHT 266

Query:   237 PGEGETAFEWHKRKSGNRFNRSDESECSSIFVEPLRWMTAVEEGALEGKLSCAHCEARLG 296
             PGEGE+ F+W  ++ G R + S E +CSS+FVEPL+WMT VE+GALEGKLSC HC ARLG
Sbjct:   267 PGEGESCFQWQNKRKGER-SYSKEQDCSSLFVEPLKWMTPVEDGALEGKLSCIHCGARLG 325

Query:   297 YFNWSGIQCSCGSWITPAFQLHKSRVDKST 326
             YFNWSGIQC+CGSWITPAFQ+ KS+VD ST
Sbjct:   326 YFNWSGIQCNCGSWITPAFQISKSKVDIST 355


GO:0000188 "inactivation of MAPK activity" evidence=IBA
GO:0006470 "protein dephosphorylation" evidence=IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA
GO:0033549 "MAP kinase phosphatase activity" evidence=IBA
GO:0043405 "regulation of MAP kinase activity" evidence=IBA
UNIPROTKB|Q2QY35 LOC_Os12g03990 "Os12g0133700 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050626-91 dusp12 "dual specificity phosphatase 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNI6 DUSP12 "Dual specificity protein phosphatase 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1C7 LOC100626531 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|68375 Dusp12 "dual specificity phosphatase 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL40 I3LL40 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MW70 DUSP12 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1890614 Dusp12 "dual specificity phosphatase 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N842 DUSP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.824
3rd Layer3.1.30.766
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 5e-27
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 5e-24
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-23
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 1e-08
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 9e-07
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 9e-07
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 9e-04
COG5350172 COG5350, COG5350, Predicted protein tyrosine phosp 0.001
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 0.002
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 0.004
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
 Score =  103 bits (258), Expect = 5e-27
 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 1/72 (1%)

Query: 103 VRMTVPIRDMESENLLDYLDVCFDFIDRRRKEGG-VLVHCFAGVSRSAAIITAYLMRTEQ 161
             + VPI D+ S+++  Y D   DFID  R++GG VLVHC AGVSRSA ++ AYLM+T  
Sbjct: 49  NYLYVPILDLPSQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLG 108

Query: 162 LSSEGALESLRQ 173
           LS   A E ++ 
Sbjct: 109 LSLREAYEFVKS 120


Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139

>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.95
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.95
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.94
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.93
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.93
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.91
PRK12361 547 hypothetical protein; Provisional 99.85
PTZ00242166 protein tyrosine phosphatase; Provisional 99.76
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.74
PTZ00393241 protein tyrosine phosphatase; Provisional 99.7
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.54
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.51
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.41
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.31
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.28
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.11
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.03
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.96
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.96
PLN02727 986 NAD kinase 98.76
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.68
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.63
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.51
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.5
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.48
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 98.1
PHA02742303 protein tyrosine phosphatase; Provisional 98.09
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.05
PHA02740298 protein tyrosine phosphatase; Provisional 98.04
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 97.97
PHA02746323 protein tyrosine phosphatase; Provisional 97.96
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 97.92
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 97.92
PHA02747312 protein tyrosine phosphatase; Provisional 97.92
PHA02738320 hypothetical protein; Provisional 97.82
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 97.52
KOG2386393 consensus mRNA capping enzyme, guanylyltransferase 97.33
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 97.23
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 96.88
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 96.78
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 96.6
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 96.28
KOG0791374 consensus Protein tyrosine phosphatase, contains f 95.46
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 93.9
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 93.77
PF0322696 Yippee-Mis18: Yippee zinc-binding/DNA-binding /Mis 93.2
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 91.56
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 90.8
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 88.7
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 80.98
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
Probab=99.95  E-value=3.4e-28  Score=204.13  Aligned_cols=133  Identities=31%  Similarity=0.445  Sum_probs=116.5

Q ss_pred             CccccCCeEecChhhhhCHHHHhhCCCcEEEEcccCCccccccccccccCCChhhhhhhccCCCCCCCCCCCCCCCCCCC
Q 020333            2 PYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSR   81 (327)
Q Consensus         2 p~~I~~~LylG~~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~   81 (327)
                      |++|.|+||+|+.+++.+.+.|+++||++||||+....                                          
T Consensus         1 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~------------------------------------------   38 (138)
T smart00195        1 PSEILPHLYLGSYSSALNLALLKKLGITHVINVTNEVP------------------------------------------   38 (138)
T ss_pred             CcEEeCCeEECChhHcCCHHHHHHcCCCEEEEccCCCC------------------------------------------
Confidence            89999999999999999999999999999999976210                                          


Q ss_pred             CCCCCchhhhhhhhccCCcceEEEEEecCCCCCCcHHHhHHHHHHHHHHHHhCC-cEEEEcCCCCchhHHHHHHHHHHHc
Q 020333           82 SCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRTE  160 (327)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~g-~VLVHC~~G~sRS~tvv~AYLm~~~  160 (327)
                        .  .          ...++.|+++|+.|....++.+.|+.+++||+..+.+| +|||||.+|+|||+++++||||..+
T Consensus        39 --~--~----------~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~v~~~yl~~~~  104 (138)
T smart00195       39 --N--L----------NKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGKVLVHCQAGVSRSATLIIAYLMKYR  104 (138)
T ss_pred             --C--C----------CCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCeEEEECCCCCchHHHHHHHHHHHHh
Confidence              0  0          01357889999999888889999999999999999877 9999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhccc--cCCCCccccCccc
Q 020333          161 QLSSEGALESLRQSCDS--YNRGEKIDSSKFG  190 (327)
Q Consensus       161 ~~s~~~A~~~vr~~rp~--~~~g~~~~~~~~~  190 (327)
                      |+++++|+++|+++||.  ++.+|..+|..|+
T Consensus       105 ~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e  136 (138)
T smart00195      105 NLSLNDAYDFVKDRRPIISPNFGFLRQLIEYE  136 (138)
T ss_pred             CCCHHHHHHHHHHHCCccCCCHhHHHHHHHHh
Confidence            99999999999999994  4567777776654



>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>PF03226 Yippee-Mis18: Yippee zinc-binding/DNA-binding /Mis18, centromere assembly; InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 3e-10
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 3e-08
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 1e-07
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-07
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 1e-07
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 1e-07
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 3e-07
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 7e-07
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 8e-07
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 1e-06
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 1e-06
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 6e-06
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 1e-05
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 4e-05
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 8e-05
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 2e-04
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 4e-04
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 4e-04
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 8e-04
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Query: 106 TVPIRDMESENLLDYLDVCFDFIDR-RRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSS 164 ++ I D+ N+L Y CF+FI+ +RK+G VLVH AGVSR+AAI+ +LM +EQ S Sbjct: 52 SISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHSNAGVSRAAAIVIGFLMNSEQTSF 111 Query: 165 EGALESLRQS 174 A ++ + Sbjct: 112 TSAFSLVKNA 121
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 7e-29
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 9e-29
2hcm_A164 Dual specificity protein phosphatase; structural g 9e-29
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-28
3emu_A161 Leucine rich repeat and phosphatase domain contain 2e-28
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 2e-28
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 3e-28
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 4e-28
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 4e-28
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 5e-28
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 1e-27
2hxp_A155 Dual specificity protein phosphatase 9; human phos 1e-27
2oud_A177 Dual specificity protein phosphatase 10; A central 1e-27
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 1e-27
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 2e-27
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 4e-27
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 8e-27
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 2e-26
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 7e-26
2q05_A195 Late protein H1, dual specificity protein phosphat 7e-26
3cm3_A176 Late protein H1, dual specificity protein phosphat 2e-25
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 3e-23
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 7e-20
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 5e-12
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 3e-09
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-09
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 8e-07
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-06
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 2e-05
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 8e-04
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
 Score =  108 bits (272), Expect = 7e-29
 Identities = 41/171 (23%), Positives = 61/171 (35%), Gaps = 49/171 (28%)

Query: 5   VREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGG 64
           V   +++GN S A DI +     ITH+L+     S        +                
Sbjct: 31  VTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFY-------------- 76

Query: 65  SGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVC 124
                                            KD  +  + +   D +  NL  Y +  
Sbjct: 77  ---------------------------------KDSGITYLGIKANDTQEFNLSAYFERA 103

Query: 125 FDFID--RRRKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQ 173
            DFID    +K G VLVHC  G SRS  ++ AYLM  +++  + AL  +RQ
Sbjct: 104 ADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQ 154


>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.96
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.96
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.96
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.95
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.95
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.94
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.94
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.94
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.94
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.94
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.94
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.94
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.94
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.94
2hcm_A164 Dual specificity protein phosphatase; structural g 99.93
2oud_A177 Dual specificity protein phosphatase 10; A central 99.93
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.93
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.93
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.92
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.92
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.91
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.89
2q05_A195 Late protein H1, dual specificity protein phosphat 99.87
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.86
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.85
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.82
1xri_A151 AT1G05000; structural genomics, protein structure 99.76
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.72
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.72
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.72
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.7
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.67
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.64
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.62
2f46_A156 Hypothetical protein; structural genomics, joint c 99.59
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.43
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.2
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 99.14
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.08
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 98.89
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 98.86
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 98.61
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 98.52
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 98.5
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 98.49
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.48
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 98.45
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 98.44
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 98.43
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 98.43
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.4
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 98.4
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 98.39
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 98.39
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 98.38
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 98.38
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.37
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 98.37
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 98.34
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 98.33
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.33
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 98.32
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 98.32
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 98.3
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.28
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 98.27
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 98.25
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.16
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 98.13
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 98.12
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 98.09
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 98.03
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 97.98
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 97.97
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 97.94
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 97.93
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.9
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.88
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 97.87
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 97.87
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 97.82
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 97.7
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 97.55
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.98
2yf0_A512 Myotubularin-related protein 6; hydrolase; 2.65A { 82.01
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=99.96  E-value=2.4e-30  Score=222.16  Aligned_cols=133  Identities=22%  Similarity=0.291  Sum_probs=116.9

Q ss_pred             CccccCCeEecChhhhhCHHHHhhCCCcEEEEcccCCccccccccccccCCChhhhhhhccCCCCCCCCCCCCCCCCCCC
Q 020333            2 PYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGSR   81 (327)
Q Consensus         2 p~~I~~~LylG~~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~   81 (327)
                      |++|.|+||||+..++.|.+.|+++|||+|||++.+.                                           
T Consensus        10 ~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~-------------------------------------------   46 (161)
T 3emu_A           10 PTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEV-------------------------------------------   46 (161)
T ss_dssp             CEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC----------------------------------------------
T ss_pred             ceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCC-------------------------------------------
Confidence            7899999999999999999999999999999997621                                           


Q ss_pred             CCCCCchhhhhhhhccCCcceEEEEEecCCCCCCcHHHhHHHHHHHHHHHHhCC-cEEEEcCCCCchhHHHHHHHHHHHc
Q 020333           82 SCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRTE  160 (327)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~g-~VLVHC~~G~sRS~tvv~AYLm~~~  160 (327)
                          ++.+         ..++.|+++|+.|.+.+++.++|+++++||++++++| +|||||.+|+|||+++++||||..+
T Consensus        47 ----~~~~---------~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~  113 (161)
T 3emu_A           47 ----PSLF---------KDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQ  113 (161)
T ss_dssp             -----------------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHT
T ss_pred             ----cccc---------CCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHh
Confidence                0000         1157889999999999999999999999999998876 9999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhcc--ccCCCCccccCccc
Q 020333          161 QLSSEGALESLRQSCD--SYNRGEKIDSSKFG  190 (327)
Q Consensus       161 ~~s~~~A~~~vr~~rp--~~~~g~~~~~~~~~  190 (327)
                      +|++++|+++||++||  .+|.||..+|..|+
T Consensus       114 ~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e  145 (161)
T 3emu_A          114 RLSFINAFNKVQGLYPLIDIESGFILQLKLFE  145 (161)
T ss_dssp             TCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHH
Confidence            9999999999999999  56778888887665



>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 3e-11
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 9e-09
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-08
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 3e-08
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 3e-08
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 7e-08
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 7e-06
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-05
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-04
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.0 bits (142), Expect = 3e-11
 Identities = 41/171 (23%), Positives = 62/171 (36%), Gaps = 49/171 (28%)

Query: 5   VREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGG 64
           V   +++GN S A DI +     ITH+L+     S        +                
Sbjct: 26  VTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFY-------------- 71

Query: 65  SGDGGSGSVDDLGDGSRSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVC 124
                                            KD  +  + +   D +  NL  Y +  
Sbjct: 72  ---------------------------------KDSGITYLGIKANDTQEFNLSAYFERA 98

Query: 125 FDFIDRR--RKEGGVLVHCFAGVSRSAAIITAYLMRTEQLSSEGALESLRQ 173
            DFID+   +K G VLVHC  G SRS  ++ AYLM  +++  + AL  +RQ
Sbjct: 99  ADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQ 149


>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.97
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.97
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.96
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.79
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.74
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.65
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.61
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.59
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.46
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 98.64
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.45
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.29
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.1
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 97.89
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 97.89
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 97.85
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 97.82
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 97.78
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 97.78
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 97.78
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 97.73
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 97.71
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 94.81
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 89.89
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 82.04
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 81.53
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=99.97  E-value=1.3e-31  Score=223.57  Aligned_cols=136  Identities=28%  Similarity=0.385  Sum_probs=119.3

Q ss_pred             CCccccCCeEecChhhhhCHHHHhhCCCcEEEEcccCCccccccccccccCCChhhhhhhccCCCCCCCCCCCCCCCCCC
Q 020333            1 MPYLVREHLFIGNISDAADILQNGSSEITHMLSVLSSASISFFTEWRSSLTIPSKEIKKVYAGGSGDGGSGSVDDLGDGS   80 (327)
Q Consensus         1 ~p~~I~~~LylG~~~~a~d~~~L~~~gIt~IVnl~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~   80 (327)
                      +|+||.|+||||+..++.|.+.|+++||++|||++.+.                                          
T Consensus         3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~------------------------------------------   40 (144)
T d1mkpa_           3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNL------------------------------------------   40 (144)
T ss_dssp             CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSC------------------------------------------
T ss_pred             CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccC------------------------------------------
Confidence            69999999999999999999999999999999997521                                          


Q ss_pred             CCCCCCchhhhhhhhccCCcceEEEEEecCCCCCCcHHHhHHHHHHHHHHHHhCC-cEEEEcCCCCchhHHHHHHHHHHH
Q 020333           81 RSCLSPTKLLYSLEYAGKDLKLVRMTVPIRDMESENLLDYLDVCFDFIDRRRKEG-GVLVHCFAGVSRSAAIITAYLMRT  159 (327)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~g-~VLVHC~~G~sRS~tvv~AYLm~~  159 (327)
                           +...       ....++.|+++|+.|.+.+++.++|+.+++||++++++| +|||||.+|+|||+++++||||++
T Consensus        41 -----~~~~-------~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~vv~aYLm~~  108 (144)
T d1mkpa_          41 -----PNLF-------ENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVTVAYLMQK  108 (144)
T ss_dssp             -----CCEE-------EEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCEEEEECSSCSHHHHHHHHHHHHHH
T ss_pred             -----Cccc-------cCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccceEEEEecccccchHHHHHHHHHHH
Confidence                 0000       012357899999999999999999999999999999877 999999999999999999999999


Q ss_pred             cCCCHHHHHHHHHhhcc--ccCCCCccccCccc
Q 020333          160 EQLSSEGALESLRQSCD--SYNRGEKIDSSKFG  190 (327)
Q Consensus       160 ~~~s~~~A~~~vr~~rp--~~~~g~~~~~~~~~  190 (327)
                      +++++++|+++|+++||  .+|.+|..+|..|+
T Consensus       109 ~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e  141 (144)
T d1mkpa_         109 LNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFE  141 (144)
T ss_dssp             HTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHH
T ss_pred             hCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
Confidence            99999999999999999  45778888776654



>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure