Citrus Sinensis ID: 020339

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------

MRMSANRIDSHGDDNMAMDYSGTLSSNPGDSKSWNWQGEEFCLQKGSNFDMSGSQFNEVILNEEDLSYMLDDETTPVKSCGDLAYQATHSGKMSKDPKEHRETYSQAKRRRMLQFDPQVLDSSLCCDEMPSAFQKSNEREDSVEEVLPGVSQWTTGLSGLSASNCDGLDSFEGWIAECLNDPEMTFTPDDMHRNFSEASDIQIDISEFCNSTNSLPTCNTNVVQQQVTRTPRNVVFKGRKSLLRTPTKLASSVAYPFAFIKPCGIHGDVTLNDINQRIHSPGSKTKQNIDDPSAYPTSAFSGKPVVGKTKIHTEGGKGSITIMRTKG

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHcccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHcccccccccccccccccccccccccccEEEEEEEccccccEEEEEEEcc

***********GDDNMAMDYSGTLSSNPGDSKSWNWQGEEFCLQKGSNFDMSGSQFNEVILNEEDLSYMLDDETTPVKSCGDLAYQATH******************KRRRMLQFDP**************************EE*LPGVSQWTTGLSGLSASNCDGLDSFEGWIAECLNDPEMTFT************************************************************KLASSVAYPFAFIKPCGIHGDVTLNDINQR***********************SGKPVVGKTKIHTEGGKGSITIMRTK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein XRI1	Required for mitotic division of the generative cell nucleus and the development of mature tricellular pollen grains, and for male and female meiosis.	probable	Q6NLW5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!