Citrus Sinensis ID: 020368

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MYIEELKGAEEEAVVKNGEEESSEYCDQNDSVSDVSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY
ccEEEcccccHHHHHHcccccccccccccccccccccccccEEEcccHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHccccEEEEEcccccccccccHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEcccccccccccccccccccccccccccEEEEEEEc
ccEEEccccccEEEEcccEEEEEEEccccccccEEcccccEEEEccHHHHHHHHHcEEEHcHHHHHHHHHHHccHcccHHHHHcHHccEEEEEEcccccccccccHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccEEEEEEccccccccccccccccHHHHHHHEEEEEEEcccHHHHHHHHHHHHHcccccccccccccccccccccHHHcccEEEEEEEc
MYIEELKGAEEEAVVkngeeesseycdqndsvsdvseIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEfrwwdrvdeelgvggvitlnepyetlvptslyhahcidhlviptrdycfapslgdiCRAVDFICENalsrqttyvhckagrgrsTTVVICYLVHhkqmtpdaAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVadkvlraprsttsqelvafddssvvivtesdldgydsslistddggeiWADLSVVYRVRVAGQAALGRISCLWLRCRaqqkipgnklgrvsscsisadhmgginVDIHVY
myieelkgaeeeavvkngeeesseycdqndsvsdvSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSrqttyvhckagrgrSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTsqelvafddssvVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQqkipgnklgrvsscsisadhmgginvdihvy
MYIEELKgaeeeavvkngeeeSSEYCDQNDSVSDVSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY
************************************EIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDI***
*YI******************************************DVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRV******************************SSVV**********************************************LW*****************************INVDIHVY
*********************************DVSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY
MYIEELKGAEEEAVVKNGEEESSEYCDQNDSVSDVSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQ**********SSCSISADHMGGINVDIHVY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYIEELKGAEEEAVVKNGEEESSEYCDQNDSVSDVSEIGKSFVVSDVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDEELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWADLSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q9ZQP1337 Putative dual specificity yes no 0.948 0.919 0.545 3e-97
Q86BN8200 Phosphatidylglycerophosph yes no 0.452 0.74 0.345 7e-21
Q66GT5193 Phosphatidylglycerophosph no no 0.458 0.777 0.329 2e-17
P0C089193 Phosphatidylglycerophosph no no 0.458 0.777 0.335 5e-17
Q8WUK0201 Phosphatidylglycerophosph yes no 0.474 0.771 0.318 7e-16
A4D256554 Dual specificity protein no no 0.366 0.216 0.300 3e-06
O60729498 Dual specificity protein no no 0.330 0.216 0.318 5e-06
A6N3Q4483 Dual specificity protein N/A no 0.299 0.202 0.323 2e-05
Q9BVJ7150 Dual specificity protein no no 0.342 0.746 0.300 2e-05
Q9BY84 665 Dual specificity protein no no 0.314 0.154 0.301 3e-05
>sp|Q9ZQP1|DSP8_ARATH Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana GN=DSP8 PE=2 SV=2 Back     alignment and function desciption
 Score =  355 bits (910), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 193/354 (54%), Positives = 233/354 (65%), Gaps = 44/354 (12%)

Query: 1   MYIEELKGAEEEAVVKNGEEESSEYCDQNDSVSDVSEIGKSFVVSDVKRVLIGAGARALF 60
           MYI+EL   +EE      E    +  D  D    VS    + +V   KR L+G GARALF
Sbjct: 1   MYIKELTETDEE----KRERSVEDNVDDGDKAVLVSR--GNVIVLTTKRALVGVGARALF 54

Query: 61  YPTLLYNVVRNKFQAEFRWWDRVDE-----------------ELGVGGVITLNEPYETLV 103
           YPTL+YNVVRNK ++EFRWWDRV E                 ELGV GVITLNEPYETLV
Sbjct: 55  YPTLVYNVVRNKLESEFRWWDRVAEFILLGAVPFPSDVPQLKELGVCGVITLNEPYETLV 114

Query: 104 PTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTV 163
           P+SLY ++CIDHLVI TRDYCFAPS+  IC+AV+FI  NA   +TTYVHCKAGRGRSTT+
Sbjct: 115 PSSLYKSYCIDHLVIATRDYCFAPSMEAICQAVEFIHRNASLGKTTYVHCKAGRGRSTTI 174

Query: 164 VICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRV--NMACLYGHVADKV 221
           VICYLV HK MTP+AAY YVRSIRPRVLLA+AQW+AV+EYY+++V    +CL    +  +
Sbjct: 175 VICYLVQHKNMTPEAAYSYVRSIRPRVLLAAAQWKAVVEYYHVKVLNTQSCLTDATSALI 234

Query: 222 LRAPRSTTSQELVAFDDSSVVIVTESDLDGYD-----SSLISTDDGGEIW---ADLSVVY 273
            R  +   S  +V FDD S+V+VT SDL+GY+     S      +G E+W   ADLS+VY
Sbjct: 235 PRNVKQVCSGNVVVFDDGSMVVVTHSDLEGYNDDDSRSRRSVKVNGNELWAAAADLSMVY 294

Query: 274 RVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY 327
           RV+V GQAA+ RISCLWL  R  QK+ G  L            MGGI+VDI VY
Sbjct: 295 RVKVVGQAAMARISCLWLGLREDQKLSGKNLS-----------MGGISVDISVY 337
May possess phosphatase activity.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q86BN8|PTPM1_DROME Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster GN=Plip PE=2 SV=1 Back     alignment and function description
>sp|Q66GT5|PTPM1_MOUSE Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Mus musculus GN=Ptpmt1 PE=1 SV=1 Back     alignment and function description
>sp|P0C089|PTPM1_RAT Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Rattus norvegicus GN=Ptpmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUK0|PTPM1_HUMAN Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Homo sapiens GN=PTPMT1 PE=1 SV=1 Back     alignment and function description
>sp|A4D256|CC14C_HUMAN Dual specificity protein phosphatase CDC14C OS=Homo sapiens GN=CDC14C PE=2 SV=2 Back     alignment and function description
>sp|O60729|CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens GN=CDC14B PE=1 SV=1 Back     alignment and function description
>sp|A6N3Q4|CC14C_HYLSY Dual specificity protein phosphatase CDC14C OS=Hylobates syndactylus GN=CDC14C PE=3 SV=1 Back     alignment and function description
>sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 Back     alignment and function description
>sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
224071155303 predicted protein [Populus trichocarpa] 0.862 0.930 0.719 1e-117
224137888334 predicted protein [Populus trichocarpa] 0.969 0.949 0.648 1e-116
118487498334 unknown [Populus trichocarpa] 0.969 0.949 0.648 1e-116
255581313333 Protein-tyrosine phosphatase mitochondri 0.902 0.885 0.702 1e-115
357476765327 Protein-tyrosine phosphatase mitochondri 0.877 0.877 0.686 1e-112
359496486325 PREDICTED: protein-tyrosine phosphatase 0.941 0.947 0.622 1e-111
357476767332 Protein-tyrosine phosphatase mitochondri 0.877 0.864 0.675 1e-110
356563352328 PREDICTED: protein-tyrosine phosphatase 0.859 0.856 0.699 1e-109
356510670328 PREDICTED: protein-tyrosine phosphatase 0.874 0.871 0.687 1e-108
449458974334 PREDICTED: putative dual specificity pro 0.960 0.940 0.616 1e-108
>gi|224071155|ref|XP_002303366.1| predicted protein [Populus trichocarpa] gi|222840798|gb|EEE78345.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/299 (71%), Positives = 236/299 (78%), Gaps = 17/299 (5%)

Query: 46  DVKRVLIGAGARALFYPTLLYNVVRNKFQAEFRWWDRVDE-----------------ELG 88
           + KRV IGAGARALFYPTLLYNVVRNK QAEFRWWDRV E                  LG
Sbjct: 5   NAKRVFIGAGARALFYPTLLYNVVRNKVQAEFRWWDRVHEFILLGAVPFPSDVPCLKGLG 64

Query: 89  VGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQT 148
           VGGVITLNEPYETLVPTSLYHA+ IDHLVIPTRDYCFAPSL DIC+AV FI EN  S +T
Sbjct: 65  VGGVITLNEPYETLVPTSLYHAYGIDHLVIPTRDYCFAPSLNDICQAVAFIHENVSSGRT 124

Query: 149 TYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRV 208
           TYVHCKAGRGRSTT+VICYLVHH QMTP+AAY+YVRSIRPRVLLASAQWQAV EYY L+V
Sbjct: 125 TYVHCKAGRGRSTTIVICYLVHHMQMTPNAAYNYVRSIRPRVLLASAQWQAVQEYYYLKV 184

Query: 209 NMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGEIWAD 268
           + +     +AD V R PR    Q +V FDD SVV+VTE+DLDGY+ S+ S   G EIWAD
Sbjct: 185 DTSDHNFKLADLVFRTPRPALLQGIVPFDDGSVVVVTEADLDGYNPSIESGPVGSEIWAD 244

Query: 269 LSVVYRVRVAGQAALGRISCLWLRCRAQQKIPGNKLGRVSSCSISADHMGGINVDIHVY 327
           LSVV RVRVAGQAAL RISCLWLRC+A QKI G +L R +SCSI ADH+G I+VDIHVY
Sbjct: 245 LSVVCRVRVAGQAALARISCLWLRCQAHQKIVGEQLNRKNSCSIRADHLGAISVDIHVY 303

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137888|ref|XP_002326465.1| predicted protein [Populus trichocarpa] gi|222833787|gb|EEE72264.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118487498|gb|ABK95576.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581313|ref|XP_002531467.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] gi|223528921|gb|EEF30917.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357476765|ref|XP_003608668.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] gi|355509723|gb|AES90865.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] Back     alignment and taxonomy information
>gi|359496486|ref|XP_002269655.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Vitis vinifera] gi|296083494|emb|CBI23463.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357476767|ref|XP_003608669.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] gi|355509724|gb|AES90866.1| Protein-tyrosine phosphatase mitochondrial [Medicago truncatula] Back     alignment and taxonomy information
>gi|356563352|ref|XP_003549928.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|356510670|ref|XP_003524059.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449458974|ref|XP_004147221.1| PREDICTED: putative dual specificity protein phosphatase DSP8-like [Cucumis sativus] gi|449523830|ref|XP_004168926.1| PREDICTED: putative dual specificity protein phosphatase DSP8-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
UNIPROTKB|Q7XC53362 OSJNBb0089A17.7 "Putative unch 0.706 0.638 0.514 9.6e-76
TAIR|locus:2058699337 AT2G35680 "AT2G35680" [Arabido 0.709 0.688 0.604 1.4e-71
UNIPROTKB|Q5JNL3341 P0638D12.17 "Putative PTEN-lik 0.501 0.480 0.536 9.9e-62
TAIR|locus:2165016228 AT5G56610 "AT5G56610" [Arabido 0.376 0.539 0.682 2.3e-58
UNIPROTKB|Q0DGM1377 Os05g0524200 "Os05g0524200 pro 0.388 0.336 0.682 1.6e-47
WB|WBGene00009207189 F28C6.8 [Caenorhabditis elegan 0.376 0.650 0.320 3.8e-21
UNIPROTKB|I2HA91189 F28C6.8 "Protein F28C6.8, isof 0.376 0.650 0.320 3.8e-21
UNIPROTKB|F1SIF5201 PTPMT1 "Uncharacterized protei 0.382 0.621 0.328 5.3e-21
MGI|MGI:1913711193 Ptpmt1 "protein tyrosine phosp 0.366 0.621 0.344 5.2e-20
RGD|1589783193 Ptpmt1 "protein tyrosine phosp 0.366 0.621 0.352 6.4e-20
UNIPROTKB|Q7XC53 OSJNBb0089A17.7 "Putative uncharacterized protein OSJNBb0089A17.7" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 609 (219.4 bits), Expect = 9.6e-76, Sum P(2) = 9.6e-76
 Identities = 124/241 (51%), Positives = 169/241 (70%)

Query:    85 EELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENAL 144
             +ELGV GV+TLNE YE LVP  LY AH I++LV+PTRDY +APS  ++CRA DFI  NAL
Sbjct:   109 KELGVCGVVTLNESYERLVPRCLYEAHGIENLVLPTRDYLYAPSFENLCRAADFIHRNAL 168

Query:   145 SRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYY 204
               + TYVHCKAGRGRSTTVV+CYLV +KQMTP  AY++VR  RPRVLLASAQ QAV ++Y
Sbjct:   169 CGKLTYVHCKAGRGRSTTVVLCYLVQYKQMTPAEAYEHVRLRRPRVLLASAQRQAVEQFY 228

Query:   205 NLRVNMACLYGHVADKVLRAPRSTTSQELVAFDDSSVVIVTESDLDGYDSSLISTDDGGE 264
              LRV  +     +   +++ P    ++ L+AFD+ + V+V++SDL+GYD+  ++ + G  
Sbjct:   229 QLRVKKSGKSICLDSPIMKPPLFLATRNLIAFDEKTFVMVSKSDLEGYDADTLAVNVGSG 288

Query:   265 IWADLSVVYRVRVAGQAALGRISCLWLRCRAQQK------IP--GNKLGRVSSCSISADH 316
             +W ++S+VYRV+ A QAA    S LW+RCRA +K      +P   N +G   SCS+ A+ 
Sbjct:   289 LW-EISLVYRVQFASQAAFAGFSYLWVRCRAPRKNKEALPVPESNNSVGS-ESCSLEAEQ 346

Query:   317 M 317
             +
Sbjct:   347 L 347
GO:0004439 "phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity" evidence=IBA
GO:0006470 "protein dephosphorylation" evidence=IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA
GO:0046855 "inositol phosphate dephosphorylation" evidence=IBA
TAIR|locus:2058699 AT2G35680 "AT2G35680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JNL3 P0638D12.17 "Putative PTEN-like phosphatase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2165016 AT5G56610 "AT5G56610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DGM1 Os05g0524200 "Os05g0524200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIF5 PTPMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589783 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZQP1DSP8_ARATH3, ., 1, ., 3, ., 4, 80.54510.94800.9198yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 3e-14
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 5e-14
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 1e-12
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 3e-11
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 6e-07
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
 Score = 68.5 bits (168), Expect = 3e-14
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 113 IDHLVIPTRD-YCFAPSLGDICRAVDFICENALSRQ-TTYVHCKAGRGRSTTVVICYLVH 170
             +L +P  D      S      AV+FI E+A S+     VHC+AG  RS T++I YL+ 
Sbjct: 45  FTYLGVPIDDNTETKIS-PYFPEAVEFI-EDAESKGGKVLVHCQAGVSRSATLIIAYLMK 102

Query: 171 HKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYN 205
            + M+ + AYD+V+  RP +       + ++EY  
Sbjct: 103 TRNMSLNDAYDFVKDRRPIISPNFGFLRQLIEYER 137

Length = 138
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
KOG1719183 consensus Dual specificity phosphatase [Defense me 100.0
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.93
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.93
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.92
PRK12361 547 hypothetical protein; Provisional 99.92
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.9
PTZ00242166 protein tyrosine phosphatase; Provisional 99.9
PTZ00393241 protein tyrosine phosphatase; Provisional 99.89
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.88
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.87
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.85
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.7
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.53
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.42
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.42
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.39
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.39
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.22
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.18
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.16
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.14
PHA02742303 protein tyrosine phosphatase; Provisional 98.92
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 98.92
KOG2386393 consensus mRNA capping enzyme, guanylyltransferase 98.92
PHA02740298 protein tyrosine phosphatase; Provisional 98.91
PLN02727 986 NAD kinase 98.91
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 98.88
PHA02746323 protein tyrosine phosphatase; Provisional 98.85
PHA02747312 protein tyrosine phosphatase; Provisional 98.85
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.82
PHA02738320 hypothetical protein; Provisional 98.78
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.77
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.73
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 98.71
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 98.65
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 98.52
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.52
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.5
KOG0791374 consensus Protein tyrosine phosphatase, contains f 98.24
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.18
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 98.14
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.1
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 97.71
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 97.59
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 97.37
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 97.16
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 96.05
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 90.88
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 81.99
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-35  Score=252.21  Aligned_cols=156  Identities=61%  Similarity=1.006  Sum_probs=146.0

Q ss_pred             hcceeeecccchhhhhhccccccchhhhhhhh------------------cCCccEEEEecCCCCccCCcccccccCcEE
Q 020368           54 AGARALFYPTLLYNVVRNKFQAEFRWWDRVDE------------------ELGVGGVITLNEPYETLVPTSLYHAHCIDH  115 (327)
Q Consensus        54 ~~~r~lf~P~l~~nvv~~~~~~~~~~~~ri~~------------------~~GI~~VVnL~~~~e~~~~~~~~~~~gI~y  115 (327)
                      .|+|++|||||+||+++++ .+.++|| ++++                  ++|++.|+++++++|...+...|+..||++
T Consensus         1 ~~ar~~fyptllynvv~~k-~s~~~wy-~~~~~v~~~~~~FrS~~~~~i~ke~v~gvv~~ne~yE~~a~s~~wk~~giE~   78 (183)
T KOG1719|consen    1 MGARVLFYPTLLYNVVREK-ASAFRWY-RIDEFVILGAMPFRSMDVPLIKKENVGGVVTLNEPYELLAPSNLWKNYGIEF   78 (183)
T ss_pred             CCceeeecHHHHHHHHHHH-Hhhhcee-eecceEEEeecccccccchHHHhcCCCeEEEeCCchhhhhhhHHHHhcccee
Confidence            4789999999999999999 7889999 5554                  779999999999999888888999999999


Q ss_pred             EEEecCCCCCCCCHHHHHHHHHHHHHHHhCCCcEEEEcCCCCChHHHHHHHHHHHhcCCCHHHHHHHHHhhCCCCcCCHH
Q 020368          116 LVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASA  195 (327)
Q Consensus       116 l~iPi~D~~~~p~~~~~~~av~fI~~~~~~g~~VLVHC~aG~gRSgtvv~aYLm~~~g~s~~eAl~~Vr~~RP~i~~n~~  195 (327)
                      +.+|+.|+...|+.+.+.++++||++....|+.|||||+||++||+|+++||||++.+|++++|++++|++||.+.+.++
T Consensus        79 L~i~T~D~~~~Ps~~~i~~aVeFi~k~asLGktvYVHCKAGRtRSaTvV~cYLmq~~~wtpe~A~~~vr~iRp~VlL~~~  158 (183)
T KOG1719|consen   79 LVIPTRDYTGAPSLENIQKAVEFIHKNASLGKTVYVHCKAGRTRSATVVACYLMQHKNWTPEAAVEHVRKIRPRVLLRPA  158 (183)
T ss_pred             EEeccccccCCCCHHHHHHHHHHHHhccccCCeEEEEecCCCccchhhhhhhhhhhcCCCHHHHHHHHHhcCcceeecHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhcc
Q 020368          196 QWQAVLEYYNLRVNMA  211 (327)
Q Consensus       196 q~~~L~~f~~l~~~~~  211 (327)
                      ||+.|.+|++....+.
T Consensus       159 Qw~~l~ef~~~~~~~~  174 (183)
T KOG1719|consen  159 QWDVLKEFYKQIVANA  174 (183)
T ss_pred             HHHHHHHHHHHHHhcc
Confidence            9999999996544443

>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 6e-13
3rgq_A156 Crystal Structure Of Ptpmt1 In Complex With Pi(5)p 6e-12
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 1e-06
4erc_A150 Structure Of Vhz Bound To Metavanadate Length = 150 1e-06
2img_A151 Crystal Structure Of Dual Specificity Protein Phosp 2e-06
1ohe_A348 Structure Of Cdc14b Phosphatase With A Peptide Liga 2e-05
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 2e-05
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 2e-05
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 7e-04
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 64/121 (52%), Gaps = 3/121 (2%)
Query: 88  GVGGVITLNEPYET--LVPTSL-YHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENAL 144
            V GVIT+NE YET  L  TS  +    ++ L + T D    P+L ++ + V F  +   
Sbjct: 28  NVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQA 87
Query: 145 SRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYY 204
             Q  YVHCKAGR RS T+V  YL+     +P+ A + +  IR  + +  +Q + + E++
Sbjct: 88  LGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFH 147
Query: 205 N 205
Sbjct: 148 K 148
>pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 Back     alignment and structure
>pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 Back     alignment and structure
>pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 9e-43
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 9e-36
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 4e-29
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 4e-25
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 1e-23
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 6e-23
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 1e-22
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 1e-21
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-20
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 4e-17
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 6e-17
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 2e-16
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 3e-16
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 4e-16
2oud_A177 Dual specificity protein phosphatase 10; A central 4e-16
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 5e-16
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 5e-16
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 5e-16
2hcm_A164 Dual specificity protein phosphatase; structural g 6e-16
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 6e-16
2hxp_A155 Dual specificity protein phosphatase 9; human phos 8e-16
3emu_A161 Leucine rich repeat and phosphatase domain contain 1e-15
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 2e-15
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 2e-15
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-15
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 3e-15
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 3e-15
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 9e-15
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 1e-14
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 4e-14
3cm3_A176 Late protein H1, dual specificity protein phosphat 2e-13
2q05_A195 Late protein H1, dual specificity protein phosphat 5e-13
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 3e-09
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 6e-09
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 2e-08
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 1e-06
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 4e-08
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 6e-08
1xri_A151 AT1G05000; structural genomics, protein structure 6e-06
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
 Score =  144 bits (364), Expect = 9e-43
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 21/148 (14%)

Query: 79  WWDRVDE------------------ELGVGGVITLNEPYETLV---PTSLYHAHCIDHLV 117
           W+ R+D                   +  V GVIT+NE YET      +  +    ++ L 
Sbjct: 1   WYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLR 60

Query: 118 IPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVICYLVHHKQMTPD 177
           + T D    P+L ++ + V F  +     Q  YVHCKAGR RS T+V  YL+     +P+
Sbjct: 61  LSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPE 120

Query: 178 AAYDYVRSIRPRVLLASAQWQAVLEYYN 205
            A + +  IR  + +  +Q + + E++ 
Sbjct: 121 EAIEAIAKIRSHISIRPSQLEVLKEFHK 148
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.94
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.94
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.94
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.94
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.94
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.94
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.93
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.93
2hcm_A164 Dual specificity protein phosphatase; structural g 99.93
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.93
2oud_A177 Dual specificity protein phosphatase 10; A central 99.93
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.93
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.92
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.92
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.92
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.92
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.92
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.92
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.91
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.91
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.91
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.9
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.9
2q05_A195 Late protein H1, dual specificity protein phosphat 99.89
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.89
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.88
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.87
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.87
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.86
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.85
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.85
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.83
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.77
1xri_A151 AT1G05000; structural genomics, protein structure 99.75
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.64
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 99.62
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.6
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.47
2f46_A156 Hypothetical protein; structural genomics, joint c 99.46
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.38
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.33
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.32
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.31
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.3
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.25
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.22
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.2
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.2
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.2
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.19
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.19
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.18
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.18
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.16
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.16
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.16
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.15
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.15
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.14
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.13
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.13
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.12
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.12
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.11
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.11
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.1
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.08
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.07
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.07
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.06
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.04
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.02
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.97
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 98.93
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.93
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 98.93
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 98.92
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 98.92
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.88
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.87
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.81
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.73
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.71
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.23
1vee_A134 Proline-rich protein family; hypothetical protein, 82.09
2yf0_A512 Myotubularin-related protein 6; hydrolase; 2.65A { 81.01
1zsq_A528 Myotubularin-related protein 2; protein-phospholip 80.09
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
Probab=99.94  E-value=8.4e-27  Score=198.21  Aligned_cols=127  Identities=30%  Similarity=0.492  Sum_probs=113.2

Q ss_pred             hhhcCCccEEEEecCCCCccC---CcccccccCcEEEEEecCCCCCCCCHHHHHHHHHHHHHHHhCCCcEEEEcCCCCCh
Q 020368           83 VDEELGVGGVITLNEPYETLV---PTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGR  159 (327)
Q Consensus        83 i~~~~GI~~VVnL~~~~e~~~---~~~~~~~~gI~yl~iPi~D~~~~p~~~~~~~av~fI~~~~~~g~~VLVHC~aG~gR  159 (327)
                      +..++||++||||+.+.+...   +...+...|++|+++|+.|....|..+.+.++++||++....+++|||||.+|+||
T Consensus        23 ll~~~gi~~Vi~l~~~~e~~~~~~~~~~~~~~gi~~~~~p~~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~R  102 (157)
T 3rgo_A           23 LVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSR  102 (157)
T ss_dssp             HHHHSCEEEEEEESCCTTTTTSSCCHHHHHHTTCEEEEECCCTTTSSCCHHHHHHHHHHHHHHHHTTCEEEEESSSSSSH
T ss_pred             HHHHcCCCEEEECccccccccccCCHHHHHHCCCeEEEecCCCCCCCChHHHHHHHHHHHHHHHHCCCEEEEECCCCCCh
Confidence            334689999999999876422   23356678999999999998678999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCHHHHHHHHHhhCCCCcCCHHHHHHHHHHHHHhhh
Q 020368          160 STTVVICYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNLRVN  209 (327)
Q Consensus       160 Sgtvv~aYLm~~~g~s~~eAl~~Vr~~RP~i~~n~~q~~~L~~f~~l~~~  209 (327)
                      ||+++++|||...++++++|++.+|++||.+.+|++|+++|.+|++.+..
T Consensus       103 sg~~~~a~l~~~~~~~~~~a~~~v~~~R~~~~~~~~~~~~L~~~~~~l~~  152 (157)
T 3rgo_A          103 SATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEITA  152 (157)
T ss_dssp             HHHHHHHHHHHHHTCCHHHHHHHHHHHSTTCCCCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999954433
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 4e-17
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 1e-16
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 2e-16
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 4e-15
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 4e-15
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 5e-15
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 4e-11
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 2e-09
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 4e-09
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 2e-06
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.0 bits (186), Expect = 4e-17
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 4/108 (3%)

Query: 85  EELGVGGVITLNEPYETL---VPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICE 141
           ++LG+  V+   E    +      + Y    I +L I   D           RA DFI +
Sbjct: 45  QKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQ 104

Query: 142 NALSRQ-TTYVHCKAGRGRSTTVVICYLVHHKQMTPDAAYDYVRSIRP 188
               +     VHC+ G  RS T+VI YL+  ++M   +A   VR  R 
Sbjct: 105 ALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNRE 152
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.94
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.93
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.92
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.9
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.89
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.88
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.85
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.72
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.59
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.28
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.13
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.96
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.95
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.91
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.9
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.89
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.85
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.84
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.82
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 98.81
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.8
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.5
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 96.43
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 83.08
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=99.94  E-value=3.9e-27  Score=197.69  Aligned_cols=117  Identities=22%  Similarity=0.266  Sum_probs=107.8

Q ss_pred             cCCccEEEEecCCCCccCCcccccccCcEEEEEecCCCCCCCCHHHHHHHHHHHHHHHhCCCcEEEEcCCCCChHHHHHH
Q 020368           86 ELGVGGVITLNEPYETLVPTSLYHAHCIDHLVIPTRDYCFAPSLGDICRAVDFICENALSRQTTYVHCKAGRGRSTTVVI  165 (327)
Q Consensus        86 ~~GI~~VVnL~~~~e~~~~~~~~~~~gI~yl~iPi~D~~~~p~~~~~~~av~fI~~~~~~g~~VLVHC~aG~gRSgtvv~  165 (327)
                      ++||++|||++.+.    +...+...++.|+++|+.|.+..+..+.|+++++||++++.+|++|||||.+|+|||+++++
T Consensus        27 ~~gI~~Iin~~~~~----~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC~~G~~RS~~vv~  102 (144)
T d1mkpa_          27 EFGIKYILNVTPNL----PNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVTV  102 (144)
T ss_dssp             HTTEEEEEECCSSC----CCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCEEEEECSSCSHHHHHHHH
T ss_pred             hCCCcEEEEccccC----CccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccceEEEEecccccchHHHHH
Confidence            58999999998763    33345567899999999998878888999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCHHHHHHHHHhhCCCCcCCHHHHHHHHHHHHH
Q 020368          166 CYLVHHKQMTPDAAYDYVRSIRPRVLLASAQWQAVLEYYNL  206 (327)
Q Consensus       166 aYLm~~~g~s~~eAl~~Vr~~RP~i~~n~~q~~~L~~f~~l  206 (327)
                      ||||++.++++++|+++|+++||.+.||.+|++||.+|++.
T Consensus       103 aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~  143 (144)
T d1mkpa_         103 AYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERT  143 (144)
T ss_dssp             HHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHT
T ss_pred             HHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999863
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure