Citrus Sinensis ID: 020393


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MMATTHVGFLSFGSFLPLPSRISFSKRRTFATLSDDPIREWILSEGKATHITKICPVGGGCINLASRYGTDAGSFFVKTNRSIGPSMFEGEALGLGAMYETRTIRAPRPFKVGALPTGGSYIIMEFIEFGSSRGNQSVFGKKLAEMHKAGKSSKGFGFDVDNTIGSTPQINKWTSNWIEFYAEHRLGYQLKLALDQYGDSTIYQRGHRLMKNLAPLFEGVNVEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHNEAEFGMSWCAGFGGSFYNSYFEVMPKQPGFEKRRDLYMLYHYLNHYNLFGSGYRSSALSIIDDYLRMLKV
cccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEECcccccccEEEEECcccEEEEEEcccccccHHHHHHHHHHHHHHcccccccccEEEcccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccEECcccccccCECcccccEEEECcccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
*****HVGFLSFGSFLPLPSRISFSKRRTFATLSDDPIREWILSEGKATHITKICPVGGGCINLASRYGTDAGSFFVKTNRSIGPSMFEGEALGLGAMYETRTIRAPRPFKVGALPTGGSYIIMEFIEFGSSRGNQSVFGKKLAEMHKAGKSSKGFGFDVDNTIGSTPQINKWTSNWIEFYAEHRLGYQLKLALDQYGDSTIYQRGHRLMKNLAPLFEGVNVEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHNEAEFGMSWCAGFGGSFYNSYFEVMPKQPGFEKRRDLYMLYHYLNHYNLFGSGYRSSALSIIDDYLRMLKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMATTHVGFLSFGSFLPLPSRISFSKRRTFATLSDDPIREWILSEGKATHITKICPVGGGCINLASRYGTDAGSFFVKTNRSIGPSMFEGEALGLGAMYETRTIRAPRPFKVGALPTGGSYIIMEFIEFGSSRGNQSVFGKKLAEMHKAGKSSKGFGFDVDNTIGSTPQINKWTSNWIEFYAEHRLGYQLKLALDQYGDSTIYQRGHRLMKNLAPLFEGVNVEPCLLHGDLWSGNISSDKNGEPVILDPACYYGHNEAEFGMSWCAGFGGSFYNSYFEVMPKQPGFEKRRDLYMLYHYLNHYNLFGSGYRSSALSIIDDYLRMLKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-ribulosamine 3-kinase, chloroplastic Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.confidentQ10SM2
Protein-ribulosamine 3-kinase, chloroplastic Initiates a process leading to the deglycation of proteins. Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions.confidentQ9LEW8
Protein-ribulosamine 3-kinase, chloroplastic Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.probableA2XBT1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JR1, chain A
Confidence level:very confident
Coverage over the Query: 35-322
View the alignment between query and template
View the model in PyMOL