Citrus Sinensis ID: 020436

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV
cHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHccccccEEEEEEccccEEEEEEcccHHHHHHHHHHHccccEEEccccccHHcEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEccccccEEEEEccccccccccccccccccccccccccccccccccEEccccccEEEEEEEccccccccccEEEEEccccccccccccccEEccccccccccccEEEEcccEEEEccccccccccc
cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHcccccccEEEEEccccEEEEEccccHHHHHHHHHHcccEEEEEccccccHHHHHHHEEEEcccccccEEEEEEEccccEEEEEEEEccccEEccEEEEccccccccccccccEccccccccccccccccccEEEccccEEEEEEEcccEEEcHEEEEEEEEEccccccccccEEEEcEEcccccccccEEEEccccEEEEccccccccccc
MAILRTVATLATATTTTAVAafafpsssssfsskshqpksqnlsffssqslsllysnksplvknfsnppsalpmdaptsdhkntsqgdqglpELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKarlvgqgvpeDFLVSAAVaefkgpdvfGVVRLAQVNMELARIEAnfsglspgkhgwsinefgdltkgavstgrvynpkiegsakeplgdlgtvvadeKGEAFFSGVKEMLRVADLIGRSIVVygtedksdsgvTAAVIARSagvgenykkicacdgtiiwesssndfvaskv
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTgvknvevdlsnqvvrilgssplkTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPkiegsakeplgdlGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVygtedksdsgvTAAVIArsagvgenyKKICACDGTIiwesssndfvaskv
MAILRtvatlatattttavaafafpsssssfssKSHQPksqnlsffssqslsllysnksPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV
***LRTVATLATATTTTAVAAFAF********************************************************************ELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLK**********RKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIE*****PLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWE***********
**IL***ATLATATTTTAVA**************************************************************************LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTG***************VSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEG**KE*LGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSN*******
MAILRTVATLATATTTTAVAAFAFP*****************LSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMD************DQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV
*AILRTVATLATATTTTAVAAF******************************************************************QGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSS**F*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILRTVATLATATTTTAVAAFAFPSSSSSFSSKSHQPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query326 2.2.26 [Sep-21-2011]
Q6PWT7274 Copper chaperone for supe yes no 0.677 0.806 0.406 6e-39
O14618274 Copper chaperone for supe yes no 0.665 0.791 0.402 7e-39
Q9JK72274 Copper chaperone for supe yes no 0.665 0.791 0.406 3e-38
Q9WU84274 Copper chaperone for supe yes no 0.665 0.791 0.394 2e-37
Q6BK66250 Superoxide dismutase 1 co yes no 0.665 0.868 0.308 2e-25
Q6BZU2234 Superoxide dismutase 1 co yes no 0.631 0.880 0.326 2e-24
Q6FU61239 Superoxide dismutase 1 co yes no 0.634 0.866 0.333 5e-21
Q6CIG2245 Superoxide dismutase 1 co yes no 0.650 0.865 0.312 2e-20
Q75DD6238 Superoxide dismutase 1 co yes no 0.641 0.878 0.346 3e-20
P40202249 Superoxide dismutase 1 co yes no 0.653 0.855 0.304 7e-20
>sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 131/241 (54%), Gaps = 20/241 (8%)

Query: 95  LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRK 154
           + E+ V M C+ CVDAV + LQ V G+++VEV L NQ+V +  + P + +   LE TGR+
Sbjct: 13  MLEFAVQMTCQSCVDAVSRSLQGVAGIQSVEVQLENQMVLVQTTLPSQVVQALLEDTGRQ 72

Query: 155 ARLVGQGVPEDFLVSAAVAEFKGPD-VFGVVRLAQVNMELARIEANFSGLSPGKHGWSIN 213
           A L G G      + AAVA   G   V GVVR  Q+  E   IE    GL PG HG  ++
Sbjct: 73  AVLKGMGSGRWQNLEAAVAILGGSGPVQGVVRFLQLTPERCLIEGTIDGLKPGLHGLHVH 132

Query: 214 EFGDLTKGAVSTGRVYNPK--IEGSAKEP---LGDLGTVVADEKGEAFFSGVKEMLRVAD 268
           +FGDLT+   S G  +NP     G  ++     GDLG V AD  G A F    E+L+V D
Sbjct: 133 QFGDLTRNCNSCGDHFNPDGMSHGGPQDSDRHRGDLGNVCADADGRAVFRMEDELLKVWD 192

Query: 269 LIGRSIVVYGTEDKSDSG--------------VTAAVIARSAGVGENYKKICACDGTIIW 314
           +IGRS+V+   ED    G              +   +IARSAG+ +N K+IC+CDG  IW
Sbjct: 193 VIGRSLVIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIW 252

Query: 315 E 315
           E
Sbjct: 253 E 253
Delivers copper to copper zinc superoxide dismutase (SOD1).
Sus scrofa (taxid: 9823)
>sp|O14618|CCS_HUMAN Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1 Back     alignment and function description
>sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 Back     alignment and function description
>sp|Q9WU84|CCS_MOUSE Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1 Back     alignment and function description
>sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCS1 PE=3 SV=2 Back     alignment and function description
>sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FU61|CCS1_CANGA Superoxide dismutase 1 copper chaperone OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|Q75DD6|CCS1_ASHGO Superoxide dismutase 1 copper chaperone OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCS1 PE=3 SV=1 Back     alignment and function description
>sp|P40202|CCS1_YEAST Superoxide dismutase 1 copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
345106302319 copper/zinc-superoxide dismutase copper 0.868 0.887 0.810 1e-133
344190168323 Cu/Zn-superoxide dismutase copper chaper 0.880 0.888 0.792 1e-132
255537177330 superoxide dismutase copper chaperone, p 0.815 0.806 0.812 1e-124
351722110304 Cu/Zn-superoxide dismutase copper chaper 0.932 1.0 0.702 1e-124
224074743323 predicted protein [Populus trichocarpa] 0.815 0.823 0.789 1e-123
449460453328 PREDICTED: copper chaperone for superoxi 0.987 0.981 0.677 1e-119
256002663314 copper/zinc superoxide dismutase copper 0.819 0.850 0.763 1e-118
225426700322 PREDICTED: copper chaperone for superoxi 0.852 0.863 0.725 1e-116
408717411322 Cu/Zn-superoxide dismutase copper chaper 0.852 0.863 0.721 1e-116
297742637253 unnamed protein product [Vitis vinifera] 0.776 1.0 0.786 1e-116
>gi|345106302|gb|AEN71836.1| copper/zinc-superoxide dismutase copper chaperone precursor [Dimocarpus longan] Back     alignment and taxonomy information
 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/290 (81%), Positives = 256/290 (88%), Gaps = 7/290 (2%)

Query: 37  QPKSQNLSFFSSQSLSLLYSNKSPLVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLT 96
           +P SQNLS FS QSLSL    + PLVKNF+N PSAL MDAPTS+H++  Q    LPELLT
Sbjct: 37  KPPSQNLSVFSPQSLSL----RLPLVKNFTNSPSALHMDAPTSNHQDDHQV---LPELLT 89

Query: 97  EYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKAR 156
           EYMVDMKCEGCV+AVK KLQTV GVKNVEVDLSNQVVRILG SP+KTMTEALEQTGRKAR
Sbjct: 90  EYMVDMKCEGCVNAVKNKLQTVNGVKNVEVDLSNQVVRILGWSPVKTMTEALEQTGRKAR 149

Query: 157 LVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFG 216
           L+GQGVPEDFLVSAAVAEFKGPD+FGVVRLAQVNMELAR EANF+GLSPGKHGWSINE+G
Sbjct: 150 LIGQGVPEDFLVSAAVAEFKGPDIFGVVRLAQVNMELARGEANFTGLSPGKHGWSINEYG 209

Query: 217 DLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVV 276
           DLT GA STG+VYNP    + KEPLGDLGT+  D+KGEAFFSGVKE LRV DLIGRSIVV
Sbjct: 210 DLTNGAASTGKVYNPTSLETVKEPLGDLGTLEVDDKGEAFFSGVKEKLRVVDLIGRSIVV 269

Query: 277 YGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 326
           YG+EDKSDSG+TAAVIARSAG+GENYKK+C CDGT IWESS+NDFV SKV
Sbjct: 270 YGSEDKSDSGITAAVIARSAGIGENYKKLCTCDGTTIWESSNNDFVTSKV 319

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|344190168|gb|AEM97866.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Corylus heterophylla] Back     alignment and taxonomy information
>gi|255537177|ref|XP_002509655.1| superoxide dismutase copper chaperone, putative [Ricinus communis] gi|223549554|gb|EEF51042.1| superoxide dismutase copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722110|ref|NP_001235441.1| Cu/Zn-superoxide dismutase copper chaperone [Glycine max] gi|12711645|gb|AAK01931.1|AF329816_1 Cu/Zn-superoxide dismutase copper chaperone precursor [Glycine max] Back     alignment and taxonomy information
>gi|224074743|ref|XP_002304450.1| predicted protein [Populus trichocarpa] gi|222841882|gb|EEE79429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460453|ref|XP_004147960.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] gi|449524344|ref|XP_004169183.1| PREDICTED: copper chaperone for superoxide dismutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|256002663|gb|ACU52585.1| copper/zinc superoxide dismutase copper chaperone precursor [Caragana jubata] Back     alignment and taxonomy information
>gi|225426700|ref|XP_002281850.1| PREDICTED: copper chaperone for superoxide dismutase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|408717411|gb|AFU52882.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742637|emb|CBI34786.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
TAIR|locus:2034740320 CCS "AT1G12520" [Arabidopsis t 0.803 0.818 0.704 5.8e-98
UNIPROTKB|Q7XTY9312 OSJNBa0019K04.8 "Os04g0573200 0.760 0.794 0.702 1.4e-89
ASPGD|ASPL0000007495247 AN6045 [Emericella nidulans (t 0.671 0.886 0.359 4.7e-32
UNIPROTKB|Q5B085247 AN6045.2 "Superoxide dismutase 0.671 0.886 0.359 4.7e-32
UNIPROTKB|E1BE86274 CCS "Uncharacterized protein" 0.641 0.762 0.405 1.1e-30
UNIPROTKB|O14618274 CCS "Copper chaperone for supe 0.650 0.773 0.396 1.1e-30
UNIPROTKB|Q6PWT7274 CCS "Copper chaperone for supe 0.622 0.740 0.4 1.4e-30
RGD|620403274 Ccs "copper chaperone for supe 0.653 0.777 0.393 1.4e-30
UNIPROTKB|J9P9H0 350 CCS "Uncharacterized protein" 0.684 0.637 0.394 1.4e-30
UNIPROTKB|I3LT87257 CCS "Copper chaperone for supe 0.638 0.809 0.378 1.4e-30
TAIR|locus:2034740 CCS "AT1G12520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 973 (347.6 bits), Expect = 5.8e-98, P = 5.8e-98
 Identities = 188/267 (70%), Positives = 228/267 (85%)

Query:    61 LVKNFSNPPSALPMDAPTSDHKNTSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTG 120
             L ++F + P A  +   TSD +N  Q D+ +P+LLTE+MVDM CEGCV+AVK KL+T+ G
Sbjct:    58 LSRSFVSSPMATAL---TSD-RNLHQEDRAMPQLLTEFMVDMTCEGCVNAVKNKLETIEG 113

Query:   121 VKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPDV 180
             ++ VEVDLSNQVVRILGSSP+K MT+ALEQTGRKARL+GQGVP+DFLVSAAVAEFKGPD+
Sbjct:   114 IEKVEVDLSNQVVRILGSSPVKAMTQALEQTGRKARLIGQGVPQDFLVSAAVAEFKGPDI 173

Query:   181 FGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEP 240
             FGVVR AQV+MELARIEANF+GLSPG H W INE+GDLT GA STG +YNP  + +  EP
Sbjct:   174 FGVVRFAQVSMELARIEANFTGLSPGTHSWCINEYGDLTNGAASTGSLYNPFQDQTGTEP 233

Query:   241 LGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTED-KSDSGVTAAVIARSAGVG 299
             LGDLGT+ AD+ GEAF+SG KE L+VADLIGR++VVY T+D KS  G+TAAVIARSAGVG
Sbjct:   234 LGDLGTLEADKNGEAFYSGKKEKLKVADLIGRAVVVYKTDDNKSGPGLTAAVIARSAGVG 293

Query:   300 ENYKKICACDGTIIWESSSNDFVASKV 326
             ENYKK+C+CDGT+IWE++++DFVASKV
Sbjct:   294 ENYKKLCSCDGTVIWEATNSDFVASKV 320
GO:0005622 "intracellular" evidence=IBA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006801 "superoxide metabolic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015680 "intracellular copper ion transport" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006878 "cellular copper ion homeostasis" evidence=TAS
GO:0016532 "superoxide dismutase copper chaperone activity" evidence=IGI;IMP
GO:0009570 "chloroplast stroma" evidence=IDA
UNIPROTKB|Q7XTY9 OSJNBa0019K04.8 "Os04g0573200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ASPGD|ASPL0000007495 AN6045 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5B085 AN6045.2 "Superoxide dismutase copper chaperone Lys7, putative (AFU_orthologue; AFUA_2G09700)" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE86 CCS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O14618 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PWT7 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620403 Ccs "copper chaperone for superoxide dismutase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9H0 CCS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LT87 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.1LOW CONFIDENCE prediction!
3rd Layer1.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00001050001
SubName- Full=Chromosome chr2 scaffold_112, whole genome shotgun sequence; (253 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00008877001
RecName- Full=Superoxide dismutase [Cu-Zn]; EC=1.15.1.1;; Destroys radicals which are normally [...] (158 aa)
  ••• ••0.415
GSVIVG00025465001
RecName- Full=Superoxide dismutase [Cu-Zn]; EC=1.15.1.1;; Destroys radicals which are normally [...] (165 aa)
  ••• ••0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 1e-154
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 2e-26
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 2e-16
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 2e-11
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 7e-10
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 8e-10
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 1e-08
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 6e-07
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 4e-06
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 7e-05
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information 
 Score =  432 bits (1113), Expect = e-154
 Identities = 185/236 (78%), Positives = 209/236 (88%)

Query: 91  LPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQ 150
           LPELLTE+MVDMKCEGCV AVK KL+T+ GVK VEVDLSNQVVR+LGSSP+K MT ALEQ
Sbjct: 3   LPELLTEFMVDMKCEGCVAAVKNKLETLEGVKAVEVDLSNQVVRVLGSSPVKAMTAALEQ 62

Query: 151 TGRKARLVGQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGW 210
           TGRKARL+GQG PEDFLVSAAVAEFKGPD+FGVVR AQV+MELARIEA FSGLSPG HGW
Sbjct: 63  TGRKARLIGQGDPEDFLVSAAVAEFKGPDIFGVVRFAQVSMELARIEAAFSGLSPGTHGW 122

Query: 211 SINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLI 270
           SINE+GDLT+GA STG+VYNP  + + +EPLGDLGT+ ADE GEA FSG KE L+V DLI
Sbjct: 123 SINEYGDLTRGAASTGKVYNPSDDDTDEEPLGDLGTLEADENGEATFSGTKEKLKVWDLI 182

Query: 271 GRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 326
           GRS+ VY T DKS  G+ AAVIARSAGVGENYKK+C+CDGT+IWES+++DFVASKV
Sbjct: 183 GRSLAVYATADKSGPGIAAAVIARSAGVGENYKKLCSCDGTVIWESTNSDFVASKV 238

Length = 238
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 326
KOG4656247 consensus Copper chaperone for superoxide dismutas 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
PLN02642164 copper, zinc superoxide dismutase 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 99.97
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.25
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.16
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.42
PRK10671 834 copA copper exporting ATPase; Provisional 97.89
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.84
TIGR0000368 copper ion binding protein. This model describes a 97.42
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.38
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.23
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.54
PRK10671 834 copA copper exporting ATPase; Provisional 96.41
TIGR0205292 MerP mercuric transport protein periplasmic compon 92.02
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 83.55
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 82.36
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-70  Score=470.55  Aligned_cols=233  Identities=47%  Similarity=0.736  Sum_probs=225.1

Q ss_pred             ceEEEEEecCcChhhHHHHHHHHhCCCCeeEEEEEcCCcEEEEEeCCChHHHHHHHHHcCcceeeecCCCcccccccceE
Q 020436           93 ELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAV  172 (326)
Q Consensus        93 ~~~~~l~VGM~C~~C~~~Ie~~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~l~~~I~~~G~~a~~~~~g~~~~~~~~~Av  172 (326)
                      ..+.+|.|.|+|++|++.|++.|+.++||.+++||+..+.+.|....++.+|.++|+.+|.++.++++|.|+.+++..++
T Consensus         6 ~~~~efaV~M~cescvnavk~~L~~V~Gi~~vevdle~q~v~v~ts~p~s~i~~~le~tGr~Avl~G~G~psaval~at~   85 (247)
T KOG4656|consen    6 TYEAEFAVQMTCESCVNAVKACLKGVPGINSVEVDLEQQIVSVETSVPPSEIQNTLENTGRDAVLRGAGKPSAVALLATV   85 (247)
T ss_pred             ceeEEEEEechhHHHHHHHHHHhccCCCcceEEEEhhhcEEEEEccCChHHHHHHHHhhChheEEecCCchhHHHHHHHH
Confidence            35688999999999999999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             EEeeCC-eeeeEEEEEeeCCCceEEEEEEccCCCCcceeEEeecCCCCCCccccCccccCCCCCCCCCCCCCCcceeeCC
Q 020436          173 AEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADE  251 (326)
Q Consensus       173 a~~~g~-~v~G~i~f~q~~~~~v~v~~~l~GL~~g~h~~HIHe~Gd~s~gc~saG~h~np~~~~h~~~~~GDLgnl~~~~  251 (326)
                      +.+.++ .|.|.+||.|..++.++|+++++||+||.|+|||||+||+++||.|+|.||||+..+|.....|||||+.+++
T Consensus        86 a~~~~~~~v~GvvRf~qvt~ek~lid~tvdGlspG~h~~~Ihe~GDlsng~~StG~~ynpf~~p~g~~~~gDLGn~~ad~  165 (247)
T KOG4656|consen   86 AKYTGPQAVQGVVRFVQVTEEKTLIDGTVDGLSPGLHGLHIHEYGDLSNGCESTGKHYNPFQEPHGCPNEGDLGNNRADK  165 (247)
T ss_pred             HHhcCCccceeEEEEEEeccccEEEEEEecCCCCcccceeEeeccccccchhhcccccCCCcCCCCCCCccccccccccc
Confidence            999987 8999999999998899999999999999999999999999999999999999999999888999999999999


Q ss_pred             CccEEEEEEecceecCCcCceEEEEecCCCC-------CCCceEEEEEeecccCCcCCceEEecCCeeeeecCCCCCccC
Q 020436          252 KGEAFFSGVKEMLRVADLIGRSIVVYGTEDK-------SDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVAS  324 (326)
Q Consensus       252 ~G~~~~~~~~~~~~l~~iiGRsvVIh~~~dd-------~g~r~aCgvI~rsag~~~n~k~~c~c~g~~~w~~~~~~~~~~  324 (326)
                      +|+++|++.|.+|+.|+|||||+||.+..||       +|+|++||||+||||+|||+|+||+|||+||||||+++|+.+
T Consensus       166 nGraf~s~~de~LkvwdlIGRsvVi~k~~ddlgg~p~nsge~la~gvIARSAGv~eN~KqiCaCdG~tiWeern~~la~k  245 (247)
T KOG4656|consen  166 NGRAFFSAPDEKLKVWDLIGRSVVISKSLDDLGGEPGNSGERLACGVIARSAGVWENNKQICACDGKTIWEERNDPLAGK  245 (247)
T ss_pred             CCcEEEecccccccHhhhhceeEEEeccccccCCCCCCcCcceeEEEeeeccccccCcceeeecCCeEehhhcCCccccc
Confidence            9999999999999999999999999999888       378999999999999999999999999999999999999987


Q ss_pred             C
Q 020436          325 K  325 (326)
Q Consensus       325 ~  325 (326)
                      +
T Consensus       246 ~  246 (247)
T KOG4656|consen  246 I  246 (247)
T ss_pred             C
Confidence            5

>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information
>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
1jk9_B249 Heterodimer Between H48f-Ysod1 And Yccs Length = 24 5e-21
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 2e-16
1qup_A222 Crystal Structure Of The Copper Chaperone For Super 3e-13
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 6e-13
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 6e-13
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 1e-12
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 5e-11
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 6e-11
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 8e-10
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 9e-10
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 9e-10
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 1e-09
2crl_A98 The Apo Form Of Hma Domain Of Copper Chaperone For 3e-09
3sod_O152 Changes In Crystallographic Structure And Thermosta 2e-08
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 2e-08
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 2e-08
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 2e-08
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 3e-08
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 3e-08
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 3e-08
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 3e-08
1cob_A151 Crystal Structure Solution And Refinement Of The Se 3e-08
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 3e-08
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 3e-08
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 3e-08
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 3e-08
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 4e-08
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 6e-08
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 7e-08
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 8e-08
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 1e-07
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 1e-07
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 2e-07
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 2e-07
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 2e-07
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 3e-07
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 4e-07
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 4e-07
3gtt_A153 Mouse Sod1 Length = 153 4e-07
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 4e-07
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 4e-07
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 5e-07
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 8e-07
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 8e-07
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 8e-07
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 8e-07
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 8e-07
3h2p_A153 Human Sod1 D124v Variant Length = 153 8e-07
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 8e-07
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 9e-07
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 9e-07
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 9e-07
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 1e-06
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 1e-06
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 1e-06
3gqf_A153 Structural And Biophysical Properties Of The Pathog 1e-06
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 1e-06
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 2e-06
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 2e-06
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 2e-06
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 2e-06
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 2e-06
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 2e-06
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 3e-06
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 4e-06
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 4e-06
3gzo_A154 Human Sod1 G93a Variant Length = 154 4e-06
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 4e-06
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 4e-06
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 4e-06
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 6e-06
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-06
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-06
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-06
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 8e-06
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 4e-05
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 4e-05
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 4e-05
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 6e-05
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 7e-05
3cjk_A68 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 2e-04
1fe4_A68 Crystal Structure Of Mercury-Hah1 Length = 68 2e-04
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 4e-04
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 4e-04
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 8e-04
>pdb|1JK9|B Chain B, Heterodimer Between H48f-Ysod1 And Yccs Length = 249 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 112/233 (48%), Gaps = 20/233 (8%)
Query: 98  YMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARL 157
           Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A +
Sbjct: 11  YAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAII 70
Query: 158 VGQGVPEDFLVS-------AAVAEFKGPDVFGVVRLAQVNMELARIEANFSGL-SPGKHG 209
            G G P    V+         + + K   V G+ R+ QV       +   +G+   G + 
Sbjct: 71  RGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYH 130
Query: 210 WSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADL 269
            SI+E GD++KG  STG+V++   E        DLG  +    G+ F S     L    L
Sbjct: 131 ASIHEKGDVSKGVESTGKVWHKFDEPIECFNESDLGKNLYS--GKTFLSA---PLPTWQL 185
Query: 270 IGRSIVVYGTEDKSDSGVTAA-------VIARSAGVGENYKKICACDGTIIWE 315
           IGRS V+  + +  ++  ++        VIARSAGV EN K++CAC G  +WE
Sbjct: 186 IGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWE 238
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|1QUP|A Chain A, Crystal Structure Of The Copper Chaperone For Superoxide Dismutase Length = 222 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure
>pdb|2CRL|A Chain A, The Apo Form Of Hma Domain Of Copper Chaperone For Superoxide Dismutase Length = 98 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|3CJK|A Chain A, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 68 Back     alignment and structure
>pdb|1FE4|A Chain A, Crystal Structure Of Mercury-Hah1 Length = 68 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 1e-65
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 3e-54
1do5_A154 Human copper chaperone for superoxide dismutase do 8e-36
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 6e-32
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 4e-24
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 1e-22
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 3e-22
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 5e-22
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 3e-21
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 4e-21
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 6e-21
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-20
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 3e-20
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 7e-20
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-19
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 3e-19
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 2e-16
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 9e-16
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 9e-16
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 8e-15
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 7e-14
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 1e-13
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 1e-13
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 2e-13
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 5e-13
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 1e-12
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 4e-12
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 3e-10
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 4e-10
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1yg0_A66 COP associated protein; open-faced beta-sandwich, 7e-08
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 1e-06
2kyz_A67 Heavy metal binding protein; structural genomics, 2e-06
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 3e-06
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 4e-05
2kkh_A95 Putative heavy metal transporter; zinc transport, 4e-05
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 6e-05
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 2e-04
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 3e-04
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 4e-04
2l3m_A71 Copper-ION-binding protein; structural genomics, c 5e-04
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 5e-04
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 5e-04
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 6e-04
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
 Score =  206 bits (524), Expect = 1e-65
 Identities = 67/243 (27%), Positives = 111/243 (45%), Gaps = 21/243 (8%)

Query: 96  TEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKA 155
             Y + M CE CV+ +K  L+ V G+ ++  D+  Q++ +  S    T+   L   G+ A
Sbjct: 9   ATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDA 68

Query: 156 RLVGQGVPEDFLVS-------AAVAEFKGPDVFGVVRLAQVNMELARIEANFS-GLSPGK 207
            + G G P    V+         + + K   V G+ R+ QV       +   +     G 
Sbjct: 69  IIRGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGN 128

Query: 208 HGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVA 267
           +  SI+E GD++KG  STG+V++        EP+         +   +  + +   L   
Sbjct: 129 YHASIHEKGDVSKGVESTGKVWHK-----FDEPIECFNESDLGKNLYSGKTFLSAPLPTW 183

Query: 268 DLIGRSIVVYGTEDKSDSGVTAA-------VIARSAGVGENYKKICACDGTIIWESSSND 320
            LIGRS V+  + +  ++  ++        VIARSAGV EN K++CAC G  +WE    D
Sbjct: 184 QLIGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWE-ERKD 242

Query: 321 FVA 323
            +A
Sbjct: 243 ALA 245
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.31
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.26
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.26
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.22
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.15
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.12
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.06
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.04
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.04
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.03
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.03
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.02
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.02
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.02
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.01
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.01
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.01
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.0
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.0
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.98
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.97
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.97
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.97
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.96
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.96
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.95
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.94
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.93
2kyz_A67 Heavy metal binding protein; structural genomics, 98.91
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.86
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.85
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.83
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.8
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.7
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.7
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.68
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.32
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.27
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.25
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
Probab=100.00  E-value=2.9e-65  Score=468.03  Aligned_cols=219  Identities=31%  Similarity=0.468  Sum_probs=203.6

Q ss_pred             eEEEEEecCcChhhHHHHHHHHhCCCCeeEEEEEcCCcEEEEEeCCChHHHHHHHHHcCcceeeecCCCcccccccceEE
Q 020436           94 LLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVA  173 (326)
Q Consensus        94 ~~~~l~VGM~C~~C~~~Ie~~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~l~~~I~~~G~~a~~~~~g~~~~~~~~~Ava  173 (326)
                      .+++|.|.|+|.+|+.+|+++|++++||..+.+|+..+++.|....++++|.++|+++||++.+...+.++    .+|||
T Consensus         7 ~~~~l~V~MtC~~Ca~~IekaL~~l~GV~~v~Vnl~~~~v~V~~~~~~~~I~~aIe~~Gy~a~~~~~~~~~----~~Av~   82 (249)
T 1jk9_B            7 YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPN----SSAVA   82 (249)
T ss_dssp             EEEEEECCCCSSSHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHTTTCCCEEEEESSTT----SEEEE
T ss_pred             eeEEEEEeeccHHHHHHHHHHHhccCCeeEEEEEcCCCeEEEecCCCHHHHHHHHHHhCCCcccccCCccc----ceeEE
Confidence            34567778999999999999999999999999999999999998888999999999999999998888787    68999


Q ss_pred             EeeCC-----------eeeeEEEEEeeCCCceEEEEEEccCC-CCcceeEEeecCCCCCCccccCccccCCCCCCCCCCC
Q 020436          174 EFKGP-----------DVFGVVRLAQVNMELARIEANFSGLS-PGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPL  241 (326)
Q Consensus       174 ~~~g~-----------~v~G~i~f~q~~~~~v~v~~~l~GL~-~g~h~~HIHe~Gd~s~gc~saG~h~np~~~~h~~~~~  241 (326)
                      +|++.           .|.|+++|+|.+++.+.|+++++||+ ||.|+|||||+|||++||.|||+||||+++.|     
T Consensus        83 ~l~~~~~~~~~~~~~~~v~G~v~f~q~~~~~~~v~~~~~GL~~~g~hg~hiHe~Gd~~~g~~saG~h~np~~~~h-----  157 (249)
T 1jk9_B           83 ILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPI-----  157 (249)
T ss_dssp             EEEESSCCTTSCTTCCSEEEEEEEEEEETTEEEEEEEEEEESSCEEEEEEEESCCCCTTGGGGGCSEEEECCSCE-----
T ss_pred             EeccccccccccccCCCcEEEEEEEEcCCCCEEEEEEEeCCCCCCcEeEEEEeCCCCCCCcccccCCcCCCCCCc-----
Confidence            99863           69999999997556899999999999 99999999999999999999999999998877     


Q ss_pred             CCCcceeeCC-CccEEEEEEecceecCCcCceEEEEecCCCCC-------CCceEEEEEeecccCCcCCceEEecCCeee
Q 020436          242 GDLGTVVADE-KGEAFFSGVKEMLRVADLIGRSIVVYGTEDKS-------DSGVTAAVIARSAGVGENYKKICACDGTII  313 (326)
Q Consensus       242 GDLgnl~~~~-~G~~~~~~~~~~~~l~~iiGRsvVIh~~~dd~-------g~r~aCgvI~rsag~~~n~k~~c~c~g~~~  313 (326)
                      ||||||.+++ +|.+.+ +++..++|++|||||||||+++||+       ++|+|||||+|++|+|||+|+||+||||||
T Consensus       158 GDlgni~~~~~~G~a~~-~~~~~~~l~~iiGrs~vvh~~~Dd~~~~~~~~~~r~aCGvI~~~~g~~~n~k~vc~c~g~~~  236 (249)
T 1jk9_B          158 ECFNESDLGKNLYSGKT-FLSAPLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTV  236 (249)
T ss_dssp             EECEECSSCTTCEEEEE-EEEESCCHHHHTTSEEEEEEECSCGGGSSSSCCEEEEEEECEECCCTTSCCCCCBCCCCCCH
T ss_pred             cccCCEEecCCCceEEE-EECCCCCccccCCeEEEEECCCccCCCCCCCCCCcEEEEEEeeccccccCCCeEecCCCccc
Confidence            9999999999 999999 8999999999999999999999984       579999999999999999999999999999


Q ss_pred             eecCCCCCc
Q 020436          314 WESSSNDFV  322 (326)
Q Consensus       314 w~~~~~~~~  322 (326)
                      ||||++.+.
T Consensus       237 w~e~~~~~~  245 (249)
T 1jk9_B          237 WEERKDALA  245 (249)
T ss_dssp             HHHHHHHTC
T ss_pred             cccCchhhh
Confidence            999986543
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 326
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 3e-24
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 6e-22
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 2e-19
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 2e-16
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 9e-16
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 2e-15
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 4e-15
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 5e-15
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 6e-15
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 6e-15
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 1e-12
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 2e-12
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 3e-12
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 4e-12
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 1e-10
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 1e-07
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 1e-07
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 2e-07
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 8e-07
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 9e-07
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-06
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 1e-06
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 1e-06
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 1e-06
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 5e-06
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 7e-06
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Copper chaperone for superoxide dismutase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 94.3 bits (234), Expect = 3e-24
 Identities = 56/151 (37%), Positives = 72/151 (47%), Gaps = 20/151 (13%)

Query: 168 VSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTG 226
           + AAVA   GP  V GVVR  Q+  E   IE    GL PG HG  ++++GDLT    S G
Sbjct: 3   LGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCG 62

Query: 227 RVYNPK-----IEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTED 281
             +NP          +    GDLG V AD  G A F    E L+V D+IGRS+++   ED
Sbjct: 63  NHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGED 122

Query: 282 --------------KSDSGVTAAVIARSAGV 298
                          S   +   +IARSAG+
Sbjct: 123 DLGRGGHPLSKITGNSGERLACGIIARSAGL 153
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 99.98
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.51
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.5
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.45
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.45
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.43
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.42
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.41
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.4
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.4
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.39
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.39
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.35
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.35
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.34
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Copper chaperone for superoxide dismutase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.7e-42  Score=290.22  Aligned_cols=132  Identities=42%  Similarity=0.634  Sum_probs=124.4

Q ss_pred             ccceEEEeeCC-eeeeEEEEEeeCCCceEEEEEEccCCCCcceeEEeecCCCCCCccccCccccCCCCCC-----CCCCC
Q 020436          168 VSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGS-----AKEPL  241 (326)
Q Consensus       168 ~~~Ava~~~g~-~v~G~i~f~q~~~~~v~v~~~l~GL~~g~h~~HIHe~Gd~s~gc~saG~h~np~~~~h-----~~~~~  241 (326)
                      +.+|||+|+++ .|+|+++|+|..++.+.|+++|+||+||.|+|||||+|||+++|.|+|+||||.+.+|     ..+|.
T Consensus         3 ~~~Ava~~~~~~~v~G~v~f~q~~~~~v~v~~~l~GL~pg~hg~HIHe~Gd~s~~~~s~Ggh~np~~~~h~~~~~~~~h~   82 (154)
T d1do5a_           3 LGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR   82 (154)
T ss_dssp             CEEEEEEEBCSSSCEEEEEEEEEETTEEEEEEEEESCCSEEEEEEEESCCCCTTGGGTTCSBCCTTCCCCCCTTCSSSCT
T ss_pred             cceEEEEECCCCccEEEEEEEEeCCCCEEEEEEEccCCCCceEEEEecCCcCCCCccccccceecccccccCCCCCCCcc
Confidence            36799999975 7999999999876789999999999999999999999999999999999999999988     67899


Q ss_pred             CCCcceeeCCCccEEEEEEecceecCCcCceEEEEecCCCCC--------------CCceEEEEEeecccCC
Q 020436          242 GDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKS--------------DSGVTAAVIARSAGVG  299 (326)
Q Consensus       242 GDLgnl~~~~~G~~~~~~~~~~~~l~~iiGRsvVIh~~~dd~--------------g~r~aCgvI~rsag~~  299 (326)
                      ||||||+++.+|++.++++++.++|++|+|||||||+++||+              |+|||||||+|+||+|
T Consensus        83 GDLgni~~~~~G~~~~~~~~~~~~l~~iiGRSiVIH~~~Dd~~~g~~~~s~~~G~aG~RiaCgvI~rsag~~  154 (154)
T d1do5a_          83 GDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF  154 (154)
T ss_dssp             TEEEEEEECTTSEEEEEEEESSCCHHHHTTSEEEEESSCCCTTCSCSTTTTTTTTCCCEEEEEECEEECCCC
T ss_pred             cccCcEEeCCCceEEEEEEcCCccccccCCcEEEEEcCCcccccCCCccccccCCCCCcEEEEEEEeecccC
Confidence            999999999999999999999999999999999999999984              5799999999999999
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure