Citrus Sinensis ID: 020448

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MRALSSFRNRLPFKLYPSASIESNNKIRNIMSASDESPCFSRPRMVAKKVHGKLSHDGDGAVVRRAIGRGDLRSLDPFLMLDEFSVSPPAGFPDHPHRGFETVTYMLQGGITHQDFSGHKGTIHTGDVQWMTAGRGIVHSEMPAGEGVQNGLQLWINLSSSDKMIEPRYQEIPSEEIKRAETDGVEVRIIAGESMGVRSPVYTRTPTMFLDFTLKPRAQIHQSIPETWNAFVYTIEGEGVFGTVNSSAVSAHNVLVLSLGDGLSAWNRSSKQLRFVLIAGQPLNEPVVQYGPFVMNSQAEIDQTIEDYQLCKNGFENAKYWRSQSQ
ccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEEcccccccccccccEEEccccccccccccccccccccEEEEEEEccEEcccccccccccccccEEEEEccccccccccccccccccEEEEEEEcccccccccccccccccccccCECcccEEEEEEEEECcccccccccccccEEEEEEEccccEEEEEcccccEEEEEEEEccEEEEccccEEEcccEEEEEEccccEEEEEccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccc
*****SFRNRLPFKLYPSASIESNNK*********************KKVHGKLSHDGDGAVVRRAIGRGDLRSLDPFLMLDEFSVSPPAGFPDHPHRGFETVTYMLQGGITHQDFSGHKGTIHTGDVQWMTAGRGIVHSEMPAGEGVQNGLQLWINLSSSDKMIEPRYQEIPSEEIKRAETDGVEVRIIAGESMGVRSPVYTRTPTMFLDFTLKPRAQIHQSIPETWNAFVYTIEGEGVFGTVNSSAVSAHNVLVLSLGDGLSAWNRSSKQLRFVLIAGQPLNEPVVQYGPFVMNSQAEIDQTIEDYQLCKNGFENAKYW*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRALSSFRNRLPFKLYPSASIESNNKIRNIMSASDESPCFSRPRMVAKKVHGKLSHDGDGAVVRRAIGRGDLRSLDPFLMLDEFSVSPPAGFPDHPHRGFETVTYMLQGGITHQDFSGHKGTIHTGDVQWMTAGRGIVHSEMPAGEGVQNGLQLWINLSSSDKMIEPRYQEIPSEEIKRAETDGVEVRIIAGESMGVRSPVYTRTPTMFLDFTLKPRAQIHQSIPETWNAFVYTIEGEGVFGTVNSSAVSAHNVLVLSLGDGLSAWNRSSKQLRFVLIAGQPLNEPVVQYGPFVMNSQAEIDQTIEDYQLCKNGFENAKYWRSQSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pirin-like protein At2g43120 confidentQ9ZW82
Pirin Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).probableO00625
Pirin Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).probableQ5M827

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J1L, chain A
Confidence level:very confident
Coverage over the Query: 42-326
View the alignment between query and template
View the model in PyMOL