Citrus Sinensis ID: 020452

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MFHTNCGTVVVVSNGPDDAEEELVSEAEISTEFDAWNELRLHPLLMKSIYRLGFKEPTPIQKACIPAAAHQGKDIIGAAETGSGKTLAFGLPIMQRLLEEREKAGKMLEEKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKEVAKGINVRVVPIVGGMSTEKQERLLKARPELVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNEGQSEQTQTCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKLKQSVNGLNSIETLSERAGMRANVAIVDLTNVSVLANKLEESFIE
ccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEccHHHHHHHHcccccEEEcccccEEEEEcccHHHccccHHHHHHHHHHcccccccccccccccccHHccccccccccccEEEEEcccccHHHHHHHccccccccccccccccHHHHHHHHcccccccEEEEEccccHHHHHHHHccc
*****CGTVVVV***************EISTEFDAWNELRLHPLLMKSIYRLGFKEPTPIQKACIPAAAHQGKDIIGAAETGSGKTLAFGLPIMQRLLEER******************PKGHLRALIITPTRELALQVTDHLKEVAKGINVRVVPIVGGMSTEKQERLLKARPELVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNG*****************LQRKKRQTLVFSATIALSADFRKKLKHGSLKLKQSVNGLNSIETLSERAGMRANVAIVDLTNVSVLANKLEESFI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFHTNCGTVVVVSNGPDDAEEELVSEAEISTEFDAWNELRLHPLLMKSIYRLGFKEPTPIQKACIPAAAHQGKDIIGAAETGSGKTLAFGLPIxxxxxxxxxxxxxxxxxxxxxAEKYAPKGHLRALIITPTRELALQVTDHLKEVAKGINVRVVPIVGGMSTEKQERLLKARPELVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNEGQSEQTQTCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKLKQSVNGLNSIETLSERAGMRANVAIVDLTNVSVLANKLEESFIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 13 probableQ93Y39

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GXQ, chain A
Confidence level:very confident
Coverage over the Query: 35-100,118-229,254-267
View the alignment between query and template
View the model in PyMOL
Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 25-232,253-268
View the alignment between query and template
View the model in PyMOL
Template: 3SQX, chain A
Confidence level:confident
Coverage over the Query: 45-99,116-254
View the alignment between query and template
View the model in PyMOL
Template: 3PEW, chain A
Confidence level:probable
Coverage over the Query: 35-97,114-214,235-290
View the alignment between query and template
View the model in PyMOL