Citrus Sinensis ID: 020520

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MAAFLPSNPSTSCCSFKFSNLPSKSHVFTLPALPLLCRRSNYHRHHLSLNRVTAALSAVDSPLKSSSDGQDEKSQPLLQVTGLTAVIAESKQEILKGVNLLVNEGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTEGSVVFKGENLLEMEPEERSLAGLFMSFQSPVEIPGVNNIDFLHMAYNARRRKLGQPEIGPIEFYAYLYPKLERLSMKTDFLNRNVNEGFSGGERKRNEILQLAVLGADLAILDEIDSGLDVDALRDVAKAVNGLLTPKNSLLMITHYRRLLEFIKPTFIHIMEDGRIIKTGDASIATVLEEGGYKAISGS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEccccccccccccEEEccccEEEEEccccccHHHHHHHHccccccCEEEEEEEEccccccccccHHHHHcccCEccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEccHHHHccccccEEEEEcccEEEEcccHHHHHHHHcccccccccc
************CCSFKFSNLPSKSHVFTLPALPLLCR***************************************LQVTGLTAVIAESKQEILKGVNLLVNEGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTEGSVVFKGENLLEMEPEERSLAGLFMSFQSPVEIPGVNNIDFLHMAYNARRRKLGQPEIGPIEFYAYLYPKLERLSMKTDFLNRNVNEGFSGGERKRNEILQLAVLGADLAILDEIDSGLDVDALRDVAKAVNGLLTPKNSLLMITHYRRLLEFIKPTFIHIMEDGRIIKTGDASIATVLEEGGYKAISG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFLPSNPSTSCCSFKFSNLPSKSHVFTLPALPLLCRRSNYHRHHLSLNRVTAALSAVDSPLKSSSDGQDEKSQPLLQVTGLTAVIAESKQEILKGVNLLVNEGEVHAIMGKNGSGKSTLSKVLVGHPDYEVTEGSVVFKGENLLEMEPEERSLAGLFMSFQSPVEIPGVNNIDFLHMAYNARRRKLGQPEIGPIEFYAYLYPKLERLSMKTDFLNRNVNEGFSGGERKRNEILQLAVLGADLAILDEIDSGLDVDALRDVAKAVNGLLTPKNSLLMITHYRRLLEFIKPTFIHIMEDGRIIKTGDASIATVLEEGGYKAISGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter I family member 6, chloroplastic Essential protein. Required during embryo development, especially at early stages. Involved in chloroplast differentiation.probableQ9CAF5
Vegetative protein 296 probableP80866
Probable ATP-dependent transporter ycf16 probableO78474

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZU0, chain C
Confidence level:very confident
Coverage over the Query: 77-320
View the alignment between query and template
View the model in PyMOL
Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 31-318
View the alignment between query and template
View the model in PyMOL