Citrus Sinensis ID: 020532


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MNQLVAMSVMRGLINGRKHSIGYARTVVRCHPNVWDGDDMPLLGLRMMVMMSSYSSSSESVPEKVKEKGENGIVPSSYWGISRPKITREDGSPWPWNCFMPWETYRADLSIDLKKHHVPTTFLDKVAYRTVKLLRIPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLLHLKSLRKFQHSGGWIKALLEEAENERMHLMTMVELVKPKWYERMLVLTVQGVFFNAFFVLYLLSPKLAHRVVGYLEEEAIHSYTEYLKDIDSGSIENVPAPAIAIDYWRLPKDATLKDVITVIRADEAHHRDVNHFASDIQFQGKELRDAPAPLGYH
ccHHHHHHHHHHHHHcccccccccHHHHHcccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccc
*****AMSVMRGLINGRKHSIGYARTVVRCHPNVWDGDDMPLL******************************VPSSYWGISRPKITREDGSPWPWNCFMPWETYRADLSIDLKKHHVPTTFLDKVAYRTVKLLRIPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLLHLKSLRKFQHSGGWIKALLEEAENERMHLMTMVELVKPKWYERMLVLTVQGVFFNAFFVLYLLSPKLAHRVVGYLEEEAIHSYTEYLKDIDSGSIENVPAPAIAIDYWRLPKDATLKDVITVIRADEAHHRDVNHFASDIQFQGK************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQLVAMSVMRGLINGRKHSIGYARTVVRCHPNVWDGDDMPLLGLRMMVMMSSYSSSSESVPEKVKEKGENGIVPSSYWGISRPKITREDGSPWPWNCFMPWETYRADLSIDLKKHHVPTTFLDKVAYRTVKLLRIPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLLHLKSLRKFQHSGGWIKALLEEAENERMHLMTMVELVKPKWYERMLVLTVQGVFFNAFFVLYLLSPKLAHRVVGYLEEEAIHSYTEYLKDIDSGSIENVPAPAIAIDYWRLPKDATLKDVITVIRADEAHHRDVNHFASDIQFQGKELRDAPAPLGYH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinol oxidase, mitochondrial Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.probableQ40294
Ubiquinol oxidase 2, mitochondrial Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.probableO22049
Ubiquinol oxidase 2, mitochondrial Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.probableQ41266

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V8T, chain A
Confidence level:probable
Coverage over the Query: 152-259,281-302
View the alignment between query and template
View the model in PyMOL