Citrus Sinensis ID: 020560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKVNLISTPCS
ccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccc
ccEEEEEccccHHHHHHHHHHHHHHHHcccccHHHcHHHHHHcEccHccccccccccccccccccccccccccEEEccccEEEEccccccccHHHcccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHccEEEEEcccc
magvslkcgdcGALLRSVQEAQEHaeltshsnfseSTEAVLNLVCAtcgkpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaidvdmsgsqpeemvepEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEhendpdidempmvpvsggggaskssltPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERrrrlglppedpattkssapvveekksmlpirpatKVEQMRECLRSLKQNHkvnlistpcs
magvslkcgdCGALLRSVQEAQEHAELtshsnfsesTEAVLNLVCATCGKpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaIDVDmsgsqpeemvEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGggaskssltpeeIKLKAQELRerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrAREKIrqkleedkaerrrrlglppedpattkssapvveekksmlpirpatkVEQMRECLRslkqnhkvnlistpcs
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGnanveaavnwvvehenDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQelrerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrarekirQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKVNLISTPCS
*******CGDCGALL**********************EAVLNLVCATCGKPC********************************************************************LEAMGFPVARATRALHYSGNANVEAAVNWVVE****************************************************************************************************************************************************************************
****SLKCGDCGALLR***************NFSESTEAVLNLVCATCGKPCR*****DLHRKRTGHTDFVDKTSEAAKPISLEVPKATAD***********************KELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEH*******************************************************************************************************L**********************************************RECLRSLKQNHKV**IS****
MAGVSLKCGDCGALLRSVQEA**************STEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDV***************DKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG*********TPEEIKLKAQEL*********************ERIRIGKELLEAKRIEEENERKRILALRK***********KIRQKLEEDKAERRRRLGLPPE***************KSMLPIRPATKVEQMRECLRSLKQNHKVNLISTPCS
*AGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPC***TETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSE**I***********MVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPV***********************RERARKKK************KERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRL**************************RPATKVEQMRECLRSLKQNHKVNLIST*C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGKELLEAKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKVNLISTPCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query324 2.2.26 [Sep-21-2011]
Q6IP50296 UBX domain-containing pro N/A no 0.518 0.567 0.367 3e-17
Q6GL77287 UBX domain-containing pro yes no 0.5 0.564 0.378 1e-16
Q6NXA9294 UBX domain-containing pro yes no 0.462 0.510 0.333 1e-15
Q6GLV4290 UBX domain-containing pro N/A no 0.518 0.579 0.343 2e-14
Q499N6297 UBX domain-containing pro yes no 0.506 0.552 0.381 8e-14
Q922Y1297 UBX domain-containing pro yes no 0.506 0.552 0.376 2e-13
Q32KW2297 UBX domain-containing pro yes no 0.512 0.558 0.359 7e-10
P45974858 Ubiquitin carboxyl-termin yes no 0.216 0.081 0.371 8e-10
P56399858 Ubiquitin carboxyl-termin no no 0.216 0.081 0.371 8e-10
Q5R407858 Ubiquitin carboxyl-termin yes no 0.216 0.081 0.371 9e-10
>sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 106/204 (51%), Gaps = 36/204 (17%)

Query: 118 LKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSS 177
           L+ L  MGF   RA +AL  +GN  +E A++W+VEHE+DPDIDE P V V  G     + 
Sbjct: 7   LESLIEMGFSSTRAEKALTATGNQGIEPAMDWLVEHEDDPDIDE-PSVVVPEGSSTDTAD 65

Query: 178 LTPEEIKLKAQELRERARK------KKEEEEKRM------------------EREREKER 213
            T        Q +   A +      +KE++ KRM                    E+EK+R
Sbjct: 66  TTDTTDTTDTQGMDTSAERLPLTEEEKEKQTKRMMELVAQKQNEREEREKKERIEQEKQR 125

Query: 214 IRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLG---- 269
            + G+EL   K+  +E E ++    R+ EK+EEK ARE++R+K+  DKA+R RR G    
Sbjct: 126 RKHGQELSAIKQKMQEQEMQKAAEDRRREKQEEKMARERVREKIARDKADRARRFGGASS 185

Query: 270 ---LPPED---PATTKS-SAPVVE 286
               PP +   PATT S S+PV E
Sbjct: 186 EPISPPAETSIPATTPSPSSPVQE 209
Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems.
Xenopus laevis (taxid: 8355)
>sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 Back     alignment and function description
>sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=2 SV=2 Back     alignment and function description
>sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 Back     alignment and function description
>sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 Back     alignment and function description
>sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 Back     alignment and function description
>sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 Back     alignment and function description
>sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
225433606413 PREDICTED: uncharacterized protein LOC10 0.972 0.762 0.828 1e-148
224140845414 predicted protein [Populus trichocarpa] 0.972 0.760 0.844 1e-130
427199320411 ubiquitin-associated/TS-N domain-contain 0.966 0.761 0.838 1e-126
224060373415 predicted protein [Populus trichocarpa] 0.956 0.746 0.816 1e-125
356525231415 PREDICTED: UBX domain-containing protein 0.969 0.756 0.801 1e-122
356512473415 PREDICTED: UBX domain-containing protein 0.969 0.756 0.795 1e-114
449442391411 PREDICTED: uncharacterized protein LOC10 0.966 0.761 0.793 1e-114
18390444413 ubiquitin-associated (UBA)/TS-N domain-c 0.959 0.753 0.796 1e-113
297848730413 ubiquitin-associated /TS-N domain-contai 0.959 0.753 0.789 1e-113
388495734410 unknown [Lotus japonicus] 0.962 0.760 0.780 1e-111
>gi|225433606|ref|XP_002273725.1| PREDICTED: uncharacterized protein LOC100248761 [Vitis vinifera] gi|298205155|emb|CBI17214.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/315 (82%), Positives = 289/315 (91%)

Query: 1   MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDL 60
           MAGVSLKCGDCGALL+SV+EAQEHAELTSHSNFSESTEAVLNL+C  C KPCRSKTE+DL
Sbjct: 1   MAGVSLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLICTICSKPCRSKTESDL 60

Query: 61  HRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKE 120
           H KRTGHT+FVDKTSEAAKPISLEVPKAT +S+E +D   S SQP+EM+ PEVDK+LL+E
Sbjct: 61  HTKRTGHTEFVDKTSEAAKPISLEVPKATDESQEVVDASGSSSQPQEMIAPEVDKKLLEE 120

Query: 121 LEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTP 180
           LEAMGFP ARATRALHYSGN ++EAAVNWVVEHEND DIDEMP+VPV+    A K SLTP
Sbjct: 121 LEAMGFPTARATRALHYSGNTSLEAAVNWVVEHENDSDIDEMPLVPVNTKVEAPKPSLTP 180

Query: 181 EEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRK 240
           EE+K+KAQELRERARKKKEEE+KRMERE+EKERIR+GKELLEAKRIEEENERKRILALR+
Sbjct: 181 EEMKIKAQELRERARKKKEEEDKRMEREKEKERIRVGKELLEAKRIEEENERKRILALRR 240

Query: 241 AEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKV 300
           AEKEEE+RAREKIRQKLEEDKAERRR+LGLPPEDPA  K SA VV+EKK+ LP++P TKV
Sbjct: 241 AEKEEEQRAREKIRQKLEEDKAERRRKLGLPPEDPAAVKPSASVVQEKKTFLPVKPVTKV 300

Query: 301 EQMRECLRSLKQNHK 315
           EQMRECLRSLKQNHK
Sbjct: 301 EQMRECLRSLKQNHK 315

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224140845|ref|XP_002323789.1| predicted protein [Populus trichocarpa] gi|222866791|gb|EEF03922.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|427199320|gb|AFY26887.1| ubiquitin-associated/TS-N domain-containing protein [Morella rubra] Back     alignment and taxonomy information
>gi|224060373|ref|XP_002300167.1| predicted protein [Populus trichocarpa] gi|118482259|gb|ABK93057.1| unknown [Populus trichocarpa] gi|222847425|gb|EEE84972.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525231|ref|XP_003531230.1| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max] Back     alignment and taxonomy information
>gi|356512473|ref|XP_003524943.1| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max] Back     alignment and taxonomy information
>gi|449442391|ref|XP_004138965.1| PREDICTED: uncharacterized protein LOC101215434 [Cucumis sativus] gi|449505284|ref|XP_004162425.1| PREDICTED: uncharacterized LOC101215434 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18390444|ref|NP_563718.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] gi|7211981|gb|AAF40452.1|AC004809_10 ESTs gb|N65605, gb|N38087, gb|T20485, gb|T13726, gb|N38339, gb|F15440 and gb|N97201 come from this gene [Arabidopsis thaliana] gi|17065066|gb|AAL32687.1| Unknown protein [Arabidopsis thaliana] gi|21594053|gb|AAM65971.1| unknown [Arabidopsis thaliana] gi|23197878|gb|AAN15466.1| Unknown protein [Arabidopsis thaliana] gi|332189630|gb|AEE27751.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848730|ref|XP_002892246.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338088|gb|EFH68505.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388495734|gb|AFK35933.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
TAIR|locus:2010637413 AT1G04850 [Arabidopsis thalian 0.574 0.450 0.654 1e-86
TAIR|locus:2156489323 AT5G48690 "AT5G48690" [Arabido 0.182 0.182 0.460 7.8e-13
UNIPROTKB|G4MXB0787 MGG_08270 "Ubiquitin carboxyl- 0.459 0.189 0.282 3.3e-05
UNIPROTKB|G4N023316 MGG_06184 "Uncharacterized pro 0.348 0.357 0.302 7.5e-05
TAIR|locus:2010637 AT1G04850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 628 (226.1 bits), Expect = 1.0e-86, Sum P(2) = 1.0e-86
 Identities = 123/188 (65%), Positives = 140/188 (74%)

Query:     1 MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDL 60
             MAGVSLKCGDCG LL+SV+EAQEHAELTSHSNF+ESTEAVLNLVC TC KPCRSK E+DL
Sbjct:     1 MAGVSLKCGDCGTLLKSVEEAQEHAELTSHSNFAESTEAVLNLVCTTCTKPCRSKIESDL 60

Query:    61 HRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKE 120
             H KRTGHT+FVDKT E  KPISLE PK   + ++  +   SG   EEMV P+VD  +L+E
Sbjct:    61 HTKRTGHTEFVDKTLETIKPISLEAPKVAMEIDD--NASGSGEAAEEMVVPDVDNNILEE 118

Query:   121 LEAMGFPVARATRALHYSGXXXXXXXXXXXXXXXXDPDIDEMPMVPVSGGGGASKSSLTP 180
             LEAMGFP ARATRALHYSG                DPD+DEMP VP +   G +K +LTP
Sbjct:   119 LEAMGFPKARATRALHYSGNASLEAAVNWVVEHENDPDVDEMPKVPSNSNVGPAKPALTP 178

Query:   181 EEIKLKAQ 188
             EE+KLKAQ
Sbjct:   179 EEVKLKAQ 186
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2156489 AT5G48690 "AT5G48690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MXB0 MGG_08270 "Ubiquitin carboxyl-terminal hydrolase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4N023 MGG_06184 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
COG5207749 COG5207, UBP14, Isopeptidase T [Posttranslational 1e-07
cd0019438 cd00194, UBA, Ubiquitin Associated domain 5e-07
pfam0062737 pfam00627, UBA, UBA/TS-N domain 1e-05
smart0016537 smart00165, UBA, Ubiquitin associated domain 1e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
pfam07227446 pfam07227, DUF1423, Protein of unknown function (D 5e-04
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 6e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 8e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PRK12705 508 PRK12705, PRK12705, hypothetical protein; Provisio 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.004
>gnl|CDD|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 52.8 bits (126), Expect = 1e-07
 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 9/85 (10%)

Query: 91  DSEEAIDVD--MSGSQPE-EMVEPEVD------KELLKELEAMGFPVARATRALHYSGNA 141
            S++ I +   MS   P+ E + P+ D      + L+++L  MGFP   A RAL  +GN 
Sbjct: 526 RSDDMIKLGSFMSKFDPQTENLLPDEDEAFTDNQSLIRQLVDMGFPEEDAARALGITGNQ 585

Query: 142 NVEAAVNWVVEHENDPDIDEMPMVP 166
           + E+A+NW+ +H +DPD+++  + P
Sbjct: 586 DAESAMNWLFQHMDDPDLNDPFVPP 610

Length = 749
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423) Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 324
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 99.97
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.95
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.94
KOG2699407 consensus Predicted ubiquitin regulatory protein [ 99.4
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 99.24
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.96
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.8
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.8
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 98.51
cd02664327 Peptidase_C19H A subfamily of Peptidase C19. Pepti 97.86
cd02668324 Peptidase_C19L A subfamily of Peptidase C19. Pepti 97.83
cd02660328 Peptidase_C19D A subfamily of Peptidase C19. Pepti 97.8
cd02667279 Peptidase_C19K A subfamily of Peptidase C19. Pepti 97.77
cd02663300 Peptidase_C19G A subfamily of Peptidase C19. Pepti 97.61
cd02657305 Peptidase_C19A A subfamily of Peptidase C19. Pepti 97.59
cd02658311 Peptidase_C19B A subfamily of Peptidase C19. Pepti 97.56
cd02661304 Peptidase_C19E A subfamily of Peptidase C19. Pepti 97.5
cd02659334 peptidase_C19C A subfamily of Peptidase C19. Pepti 97.44
cd02674230 Peptidase_C19R A subfamily of peptidase C19. Pepti 97.37
cd02673245 Peptidase_C19Q A subfamily of Peptidase C19. Pepti 97.26
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 97.04
KOG1865545 consensus Ubiquitin carboxyl-terminal hydrolase [P 96.86
cd02671332 Peptidase_C19O A subfamily of Peptidase C19. Pepti 96.79
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 96.65
cd02662240 Peptidase_C19F A subfamily of Peptidase C19. Pepti 95.85
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 95.77
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 95.55
COG5533415 UBP5 Ubiquitin C-terminal hydrolase [Posttranslati 95.5
cd02672268 Peptidase_C19P A subfamily of Peptidase C19. Pepti 95.16
KOG4598 1203 consensus Putative ubiquitin-specific protease [Po 95.05
KOG0011340 consensus Nucleotide excision repair factor NEF2, 94.91
cd02257255 Peptidase_C19 Peptidase C19 contains ubiquitinyl h 94.86
KOG0011340 consensus Nucleotide excision repair factor NEF2, 94.39
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 93.82
cd02669440 Peptidase_C19M A subfamily of Peptidase C19. Pepti 93.82
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 93.74
KOG1866 944 consensus Ubiquitin carboxyl-terminal hydrolase [P 93.69
PTZ00266 1021 NIMA-related protein kinase; Provisional 92.33
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 91.79
smart0054643 CUE Domain that may be involved in binding ubiquit 91.62
COG5560823 UBP12 Ubiquitin C-terminal hydrolase [Posttranslat 91.45
PF00443269 UCH: Ubiquitin carboxyl-terminal hydrolase; InterP 90.71
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 89.42
KOG2412 591 consensus Nuclear-export-signal (NES)-containing p 88.75
COG177355 Rubredoxin [Energy production and conversion] 87.38
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 86.71
cd02670241 Peptidase_C19N A subfamily of Peptidase C19. Pepti 86.38
PF08882112 Acetone_carb_G: Acetone carboxylase gamma subunit; 86.19
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 86.15
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 85.95
KOG1868653 consensus Ubiquitin C-terminal hydrolase [Posttran 85.73
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 85.53
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 85.44
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 85.3
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 85.21
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 84.04
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 83.39
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 81.37
PRK12332198 tsf elongation factor Ts; Reviewed 81.2
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=5.3e-32  Score=276.76  Aligned_cols=157  Identities=29%  Similarity=0.443  Sum_probs=132.5

Q ss_pred             CceeecccCcccccchHHHH----------------HHHHHcccCCCCchhhhhhhcccCCCCCCCCCcccccccccccc
Q 020560            3 GVSLKCGDCGALLRSVQEAQ----------------EHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTG   66 (324)
Q Consensus         3 ~~~L~C~~C~~v~~~~~eaq----------------~hae~TgH~~F~E~~e~v~e~~C~~Cg~~~~~~~e~~~a~K~t~   66 (324)
                      .-|++|..|++|.++...-+                ..-+ ...++|..   .|++|+|++||.|       .+|+|+|+
T Consensus       438 e~Rv~C~~c~kVrYs~~~~~~i~lpv~~~~~v~~~v~~~~-cleaff~p---q~~df~s~ac~~K-------~~a~kt~~  506 (763)
T KOG0944|consen  438 EDRVSCLGCRKVRYSYESEYLIQLPVPMTNEVREKVPISA-CLEAFFEP---QVDDFWSTACGEK-------KGATKTTR  506 (763)
T ss_pred             hhhhhhhccccccccchhheeeEeeccccccccccCCHHH-HHHHhcCC---cchhhhhHhhcCc-------cccccccc
Confidence            45899999999996554422                1111 23334444   4789999999998       89999999


Q ss_pred             ccccccchhhccccccccc--Cccc---cCCccccccCCC---CC-CCCCc--------cccccCHHHHHHHHhCCCCHH
Q 020560           67 HTDFVDKTSEAAKPISLEV--PKAT---ADSEEAIDVDMS---GS-QPEEM--------VEPEVDKELLKELEAMGFPVA  129 (324)
Q Consensus        67 f~tFPd~L~v~~~r~~l~~--p~K~---~~~~~~lDl~~~---g~-~~Ee~--------~~~~vd~~~l~~L~~MGF~~~  129 (324)
                      |+|||+||+||+.||.|.+  |+|+   +.+|+.|||+.|   |+ |+|+.        +.+.+|+.++.||++||||.+
T Consensus       507 ~ksfP~yLiiqv~rf~~~dw~pkKld~~iempe~ldls~~rs~g~~p~ee~lpde~~~~~~~~~d~s~i~qL~~MGFp~e  586 (763)
T KOG0944|consen  507 FKSFPDYLIIQVGRFTLQDWVPKKLDVSIEMPEELDLSSYRSKGLQPGEEALPDEAPETSEFAADRSVISQLVEMGFPEE  586 (763)
T ss_pred             cccCCceEEEEeeEEEecCceeeeeccceecchhhchhhhhhcCCCCcccccCCcCcccCccchhHHHHHHHHHcCCCHH
Confidence            9999999999999999977  9999   779999999988   65 66632        345589999999999999999


Q ss_pred             HHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCCCCCCCCC
Q 020560          130 RATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGG  170 (324)
Q Consensus       130 ~a~kAL~~Tgn~~~E~A~~WL~~H~dD~didep~~~~~~~~  170 (324)
                      +|.|||++|||+++|+|+||||+||+||||++|+.+|+++.
T Consensus       587 ac~rAly~tgN~~aEaA~NWl~~HMdDpd~~~p~vvp~~~~  627 (763)
T KOG0944|consen  587 ACRRALYYTGNSGAEAASNWLMEHMDDPDIDDPFVVPGNSP  627 (763)
T ss_pred             HHHHHHhhhcCccHHHHHHHHHHhccCcccCCceecCCCCC
Confidence            99999999999999999999999999999999999988654

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02664 Peptidase_C19H A subfamily of Peptidase C19 Back     alignment and domain information
>cd02668 Peptidase_C19L A subfamily of Peptidase C19 Back     alignment and domain information
>cd02660 Peptidase_C19D A subfamily of Peptidase C19 Back     alignment and domain information
>cd02667 Peptidase_C19K A subfamily of Peptidase C19 Back     alignment and domain information
>cd02663 Peptidase_C19G A subfamily of Peptidase C19 Back     alignment and domain information
>cd02657 Peptidase_C19A A subfamily of Peptidase C19 Back     alignment and domain information
>cd02658 Peptidase_C19B A subfamily of Peptidase C19 Back     alignment and domain information
>cd02661 Peptidase_C19E A subfamily of Peptidase C19 Back     alignment and domain information
>cd02659 peptidase_C19C A subfamily of Peptidase C19 Back     alignment and domain information
>cd02674 Peptidase_C19R A subfamily of peptidase C19 Back     alignment and domain information
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG1865 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02671 Peptidase_C19O A subfamily of Peptidase C19 Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02662 Peptidase_C19F A subfamily of Peptidase C19 Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02672 Peptidase_C19P A subfamily of Peptidase C19 Back     alignment and domain information
>KOG4598 consensus Putative ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>cd02669 Peptidase_C19M A subfamily of Peptidase C19 Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1866 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>cd02670 Peptidase_C19N A subfamily of Peptidase C19 Back     alignment and domain information
>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits) Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG1868 consensus Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 1e-22
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 7e-22
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 1e-21
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 3e-21
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 4e-19
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 1e-15
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 7e-15
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 4e-13
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 3e-07
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 1e-11
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 2e-11
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 1e-07
3by4_A212 OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 5e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-04
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 4e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 7e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-04
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 1e-04
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 6e-04
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
 Score = 88.8 bits (220), Expect = 1e-22
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 110 EPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG 169
              +D+ ++ +L  MGFP+    +A++Y+GN+  EAA+NWV+ H +DPD     ++P S 
Sbjct: 5   SSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSS 64

Query: 170 GGGASKSS 177
           G G+S  S
Sbjct: 65  GPGSSGPS 72
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 84 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Length = 212 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.84
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.74
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.68
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.67
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.63
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.61
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.61
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.53
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.47
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.38
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.36
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.29
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.28
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 99.26
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.25
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.23
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.22
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 99.18
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.15
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.13
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.08
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.98
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 98.96
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.95
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.87
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.73
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.73
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.7
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.69
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.65
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.51
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.42
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.28
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.2
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.14
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.13
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.09
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 97.91
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 97.82
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 97.74
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 97.71
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 97.65
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.65
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 97.58
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 97.57
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.5
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 97.33
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 97.28
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.25
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 97.04
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 96.95
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 96.68
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 96.34
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 95.81
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 94.49
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 93.84
2dhy_A67 CUE domain-containing protein 1; structural genomi 88.82
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 87.96
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 86.74
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 85.95
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 85.2
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 84.43
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 84.11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 84.09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 83.06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 83.04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 81.69
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 81.32
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 81.28
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 80.37
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 80.1
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 80.09
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=3.7e-22  Score=212.34  Aligned_cols=123  Identities=29%  Similarity=0.484  Sum_probs=103.9

Q ss_pred             hhhhhcccCCCCCCCCCccccccccccccccccccchhhccccccccc---Cccc---cCCccccccCCC---CC-CCCC
Q 020560           38 EAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEV---PKAT---ADSEEAIDVDMS---GS-QPEE  107 (324)
Q Consensus        38 e~v~e~~C~~Cg~~~~~~~e~~~a~K~t~f~tFPd~L~v~~~r~~l~~---p~K~---~~~~~~lDl~~~---g~-~~Ee  107 (324)
                      |.+..|+|+.|+.+       ..++|++.|.+||++|+|+++||.++.   +.|+   +..|..|||+.|   |. ++|+
T Consensus       559 E~Le~y~C~~C~~k-------~~a~K~~~i~~lP~vLiihLkRF~~d~~~~~~Ki~~~V~FP~~LDl~~y~~~~~q~~E~  631 (854)
T 3ihp_A          559 EQVDDFWSTALQAK-------SVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEE  631 (854)
T ss_dssp             EEEEEEEETTTTEE-------EEEEEEEEESSCCSEEEEEECCEEECGGGCEEECCEECCCCSEEECGGGBCCCSCTTCC
T ss_pred             eEeeeeeccccCCc-------ceeeEEEEeeeCCceEEEEeehheecCCCceEECCeEEecCCcEehHHhccCCCCCCce
Confidence            33444999999987       789999999999999999999999953   8888   778899999988   44 5553


Q ss_pred             c--------------cccccCHHHHHHHHhCCCCHHHHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCCCCCC
Q 020560          108 M--------------VEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPV  167 (324)
Q Consensus       108 ~--------------~~~~vd~~~l~~L~~MGF~~~~a~kAL~~Tgn~~~E~A~~WL~~H~dD~didep~~~~~  167 (324)
                      .              ..+.+|+++|++|++|||+.++|.+||+.|||.+++.||+|||+||+|+||++|+..+.
T Consensus       632 ~lp~~~~~~~~~~~~~~~~~d~~~l~~L~~mGf~~~~~~kal~~t~n~~~e~a~~wl~~hmdd~di~~p~~~~~  705 (854)
T 3ihp_A          632 ELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPG  705 (854)
T ss_dssp             BCCCC----------------CHHHHHHHHHTCCHHHHHHHHHHTTSCCHHHHHHHHHHHTTSCGGGSCCCCC-
T ss_pred             ecccccccccccccccccCcCHHHHHHHHhcCCCHHHHHHHHhhcCCCchHHHhHHHhhccCcccccccccccc
Confidence            1              13457899999999999999999999999999999999999999999999999997764
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Back     alignment and structure
>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Back     alignment and structure
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 324
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 2e-20
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 7e-20
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 3e-17
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 1e-16
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 3e-12
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 3e-10
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 4e-10
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 8e-07
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 3e-05
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: UBA/UBX 33.3 kDa protein
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 81.4 bits (201), Expect = 2e-20
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 111 PEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG 169
              +   L+ L  MGFP  RA +AL  +GN  +EAA++W++EHE+DPD+DE    P SG
Sbjct: 6   SGAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLSGPSSG 64
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.78
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.77
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.76
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.64
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.55
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.31
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.27
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.13
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.06
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 98.41
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.79
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.77
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.77
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 97.74
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 97.4
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.88
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 96.48
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 96.31
d1nbfa_347 Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU 95.87
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 95.55
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 93.93
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 93.69
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 93.05
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 93.05
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 92.86
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 92.44
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 89.41
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 88.23
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Suppressor of T-cell receptor signaling 2 (STS-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=4.8e-20  Score=131.76  Aligned_cols=50  Identities=42%  Similarity=0.701  Sum_probs=47.8

Q ss_pred             CHHHHHHHHhCCCCHHHHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCC
Q 020560          114 DKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMP  163 (324)
Q Consensus       114 d~~~l~~L~~MGF~~~~a~kAL~~Tgn~~~E~A~~WL~~H~dD~didep~  163 (324)
                      |+++|++|++|||++++|++||++|||.++|.|++|||+|++|||+|+|+
T Consensus         2 ~p~~v~~L~~MGF~~~~a~~Al~~t~n~~ve~A~~Wl~~h~~d~d~d~Pl   51 (51)
T d2crna1           2 SPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPI   51 (51)
T ss_dssp             SCSSHHHHHHTSCCHHHHHHHHHHHTSCCHHHHHHHHHHHSSSTTSCCSC
T ss_pred             CHHHHHHHHHcCCCHHHHHHHHHHHCCCCHHHHHHHHHHcCCCcCcCCCC
Confidence            56789999999999999999999999999999999999999999999986
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure